KEGG   Thermothielavioides terrestris: THITE_2057535Help
Entry
THITE_2057535     CDS       T02228                                 

Definition
(RefSeq) mitochondrial 54S ribosomal protein YmL44
  KO
K17434  large subunit ribosomal protein L53
Organism
ttt  Thermothielavioides terrestris
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ttt03011]
    THITE_2057535
Ribosome [BR:ttt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    THITE_2057535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 11522712
NCBI-ProteinID: XP_003656763
JGI: Thite2_2057535
UniProt: G2RFE4
Position
5:join(2310962..2311142,2311465..2311580)
Genome map
AA seq 98 aa AA seqDB search
MITRFITDVSTRFNPFSARAKSARLFLSLLPPTARASGMNITTQLLPRTSTEPSTLYIKF
KDGKEMNLDCESMGIKSIVEEVDRHSRALQKEADLAEA
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgataacccggttcatcacggacgtgtcgacacgcttcaaccccttctcggcgcgggcc
aagtcggcgcggctgttcctgtcgctgctgccgccgacggcgcgggcgtcgggcatgaac
atcacgacgcagctgctgccgcggacgtcgacggagccgagcacgctgtatatcaagttc
aaggacggcaaggaaatgaacctcgactgcgaatccatgggcatcaagagcatcgttgag
gaggtcgaccggcactcgcgcgcgctgcagaaggaggctgatttggctgaagcctga

DBGET integrated database retrieval system