KEGG   Thielavia terrestris: THITE_2110175Help
Entry
THITE_2110175     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
ttt  Thielavia terrestris
Pathway
ttt00910  Nitrogen metabolism
ttt01100  Metabolic pathways
Module
ttt_M00531  Assimilatory nitrate reduction, nitrate => ammonia
ttt_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    THITE_2110175
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     THITE_2110175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox NIR_SIR Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C NAD_binding_7 K_oxygenase
Motif
Other DBs
NCBI-GeneID: 11515625
NCBI-ProteinID: XP_003650576
JGI: Thite2_2110175
UniProt: G2QRU6
Position
1:complement(join(7893509..7894640,7894701..7896739,7896803..7896953,7897037..7897101))
Genome map
AA seq 1128 aa AA seqDB search
MAVGARKRVVVVGLGMVGISFIEKLLKLDARAREYNITVIGEEKHVAYNRVGLTTFFEHR
KVENLYLNPLTWYDSIVDGALSYRINTKVTKIDSTRKTISCSDGQEIPYDILVLATGSDA
ILPRFIPNHDATGVFVYRTVDDLEKLIAFSASQKGASAAVVGGGLLGLEAAKALLDLQCY
DKVKVIERGGWLLSRQVDADAGAMVADQVRQLGVDVMLNKSVSRIEVDEQHNLTGITFAD
GEFYACSTLCFAIGVRPRDELAREAGLKCAERGGGIIVDDCLRTSDPDIYAIGECANWEG
QTFGLIAPGVEMADLLSFNLTQAKHHQPRLYKRPDLSTKLKLLGVEVASFGDYFADIEGP
KFLPARAKKVNGVNGANGTDGTQGANGANGATNGVKGLSPKLVKSLTYRDPFQNVYKKYL
FTQDGKYLLGGMMIGDTKDYVKLVPMVKNQKELDIPPAELILGAKKDGDDADDLDDDTQI
CSCHNVTKGDIVKVVKDGTCKSIGDVKSCTKAGTGCGGCVPLVTSIFNKTMKDMGNEVKN
NLCPHFNYSRADLYHIIMVKRLKTLPEVMKEAGVDPNSSGCEVCKPCLGSIFSSLWNKHV
MDKPHHGLQDTNDRFLGNIQRNGTFSVVPRVPGGEITPDKLIVIGQVAKEYNLYTKITGG
QRIDMFGAKKQDLLDIWKRLVDAGMESGHAYAKALRTVKSCVGTTWCRFGIGDSVGMAVR
LEERYKSIRAPHKIKGAVSGCVRECAEAQNKDFGLIATDKGFNIFVAGNGGAKPKHAELL
AKDVPPTEVIPILDRYLMFYIRTADKLQRTARWLESLPGGIKYLREVILEDKLDINASLE
AQMQELVDSFFDEWAEAINNPSIAAKFKQFANTAETVENMELEQDRTQTRPVMWPKDAPN
EDFAGLRSRWSQTTWQPVLEASYFAGADALPNGISATIKRGDTQLAVWRFKGRYYATQQM
CPHKRAFILADGLVGEDPPSCPASASTTSSDTTTPPQTPPQASPNSPWISCPHHKRNFDL
TSGACKSDATLSIATFDVEERPDGMVYLRLPPVDELDAALGTRRWMVKKGEAGPGQFAEV
DKKIGFVGRRAKKPGVKPVGPGGGALGAVRKGVELMAVGGGCGAAPEW
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgggcgcgcgcaaaagagttgtggttgtcggcctgggcatggtcggcatcagc
ttcatagaaaaactcctaaagcttgacgcgcgggcacgcgagtacaacatcacggtcatc
ggcgaggaaaaacatgtggcctacaaccgggtcggcctcaccaccttcttcgagcaccgc
aaggttgagaatctgtatctgaacccgcttacatggtacgatagcattgtcgacggggcc
ctgagctaccgtatcaacaccaaggtcaccaagatcgactcgacgaggaagactatcagc
tgctcagacggccaggagataccatacgacattctggttctggccacgggctccgatgcc
atcctacccaggttcatccccaaccacgatgctaccggtgtcttcgtttaccggacggtc
gacgacctcgagaagctcattgccttctcggcctcccaaaaaggcgcctctgccgccgtc
gttggcggcggcctgctggggctcgaagccgccaaggccttgttggatctgcagtgctac
gacaaggttaaggtgattgaacgtggcggatggctcctcagccgccaggtggatgccgac
gccggcgccatggtggccgaccaggtccgccagctcggcgtggatgtcatgctcaacaag
agcgtgagcaggatagaggtcgacgagcagcacaacctaacaggaataaccttcgctgac
ggcgaattctatgcctgctcgacgctgtgcttcgccatcggcgtccggccaagggatgag
ctggccagagaggccggtctcaagtgcgccgaacggggcggcggcatcattgtcgacgac
tgtctcagaaccagcgatcctgacatttacgccatcggcgagtgcgccaactgggagggc
cagacctttggcctgattgcccctggggtcgagatggctgatctcctgtccttcaacctg
acccaggcaaagcaccaccagccccggctatacaagcgccccgacctcagcactaagctc
aaactcctcggcgtcgaagtggccagcttcggcgattactttgccgacatcgaggggccc
aagttcctgccagcgagagcgaagaaggtgaacggggtcaacggcgccaacggcaccgac
gggacccagggagcaaatggtgccaacggagccaccaacggcgtcaagggcctgtcacca
aagttggtgaagtcgttgacttacagagaccccttccagaacgtgtacaagaagtacctc
tttacccaggacggcaagtacctactcggtggcatgatgattggagacaccaaggactac
gtcaagctggtgcccatggtcaagaaccagaaggagctcgacatcccgccggctgaactc
atcctcggcgccaagaaggatggcgatgacgccgacgacttggacgacgacacccagatc
tgcagctgccacaacgttaccaagggcgacatagtcaaggtcgtcaaggacggcacgtgc
aagtcgatcggcgatgtgaagtcgtgcaccaaagccggcacgggctgcggtggctgcgtt
ccgctggtcacgtccatctttaacaagaccatgaaggacatgggcaacgaggtcaagaac
aacctctgcccgcacttcaactacagccgcgccgacctgtaccacatcatcatggtcaag
cggctgaagacgctgcccgaggtgatgaaggaagccggcgtcgaccccaacagctccggc
tgcgaggtctgcaagccgtgtctcggcagcatcttctcaagcttgtggaacaagcacgtc
atggacaagccgcaccacggcctgcaagacaccaacgaccgcttcctcggaaacatccag
cgcaacggcaccttcagtgtcgtgccgcgggtacccggcggcgagatcacgcccgacaaa
ctcatcgtcataggccaggtggctaaggaatacaacctgtacaccaagatcacgggcggc
cagcgcatcgacatgttcggtgccaagaagcaggacctgctcgacatctggaagcggctg
gtcgacgcgggcatggagagcggccacgcgtatgccaaggccctgcggacggtaaagagt
tgcgtcggcacgacatggtgccgattcggcatcggcgacagcgtgggcatggcggtgcgc
ctggaggaacgctacaagagcatccgggcgccgcacaagatcaagggtgctgtgagcggc
tgtgtgcgagagtgcgcggaagcgcagaacaaggacttcggccttatcgccaccgacaag
ggtttcaacatcttcgtcgccggcaacggcggcgccaagccgaagcacgcggagctcctt
gccaaggatgtgccgccgaccgaggtgatcccgattctcgaccggtacctgatgttctac
atccgcacagccgacaagctccagcgcaccgcgcgctggctagagtccctgcccggcggt
atcaagtacctccgcgaggtgatcctcgaagacaagctcgacatcaacgcgtcgctcgag
gcgcagatgcaggagctcgtcgacagcttcttcgacgagtgggccgaggccatcaacaac
ccgtccatcgcggccaagttcaagcagttcgccaacacggccgagacggtcgagaacatg
gagctcgagcaggaccgcacccagacgcggccggtcatgtggcccaaggacgcgcccaac
gaggacttcgccggcctccgctcgcgctggtcgcagaccacgtggcagccggtgctggag
gcgtcctacttcgccggcgccgacgccctgcccaacggcatcagcgcgaccatcaagcgc
ggcgacacccagctcgccgtctggcgcttcaagggccgctactacgccacgcagcagatg
tgcccgcacaagcgcgccttcatcctagccgacggcctcgtcggcgaggaccccccgtcc
tgccccgcctccgcctccaccacctcctccgacaccaccacccctccccaaaccccgcct
caagcctcccccaacagcccctggatctcctgcccccaccacaagcgcaacttcgacctg
acctcgggcgcctgcaagtcggacgcgaccctctccatcgcgaccttcgacgtcgaggag
cgccccgacggcatggtctacctgcggctgccgcccgtcgacgagctggacgcggccctc
ggcacgcgccggtggatggtcaagaagggcgaggccggacccggccagttcgccgaggtc
gacaagaagatcggcttcgtcggccgccgcgccaagaagcccggcgtcaagcccgtcggg
cccggcggcggcgcgctgggggcggtcaggaagggggtcgagttgatggcggtgggtggt
gggtgcggagcggcgccggagtggtga

DBGET integrated database retrieval system