KEGG   Thermothielavioides terrestris: THITE_2115438Help
Entry
THITE_2115438     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ttt  Thermothielavioides terrestris
Pathway
ttt00564  Glycerophospholipid metabolism
ttt00565  Ether lipid metabolism
ttt00590  Arachidonic acid metabolism
ttt00592  alpha-Linolenic acid metabolism
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    THITE_2115438
   00565 Ether lipid metabolism
    THITE_2115438
   00590 Arachidonic acid metabolism
    THITE_2115438
   00591 Linoleic acid metabolism
    THITE_2115438
   00592 alpha-Linolenic acid metabolism
    THITE_2115438
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     THITE_2115438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 11517552
NCBI-ProteinID: XP_003653232
JGI: Thite2_2115438
UniProt: G2R4F2
Position
2:7392929..7395343
Genome map
AA seq 804 aa AA seqDB search
MAFIARGCRPWIGLRCHGPSPGFRYHDSRRCFFSARQQPRLRVHTSKLISVTITSVLLAF
WLYPADAPQHTDYPAKVAPGADPGDCGDPAAPDDVDQSAWSKFTRNFAGISLVPSTDVLS
ERVAGLMPDWFKLMPGYVRKLQRELNMAPGSLAAEIWQEASDPLVHPEIHYSAKVRVSGE
LCDEEKTFLERRRKMIVPALARYLGIEEGDIHPDDVPTIAMCGSGGGLRALVAGTGSFLA
TAEDGLFDCVTYVSGVSGSCWLQSLYYSSVTGANFHRAIDHLKARLGTHIAYPPVAFASL
TSSPTNKYLLSGVVEKLKGDPGAQFGLVDVYGMLLAARLLIPKGELGVNEKDFKLSNQRE
YVKYGQNPLPIYTAVRHEIPELDSPDYGGPGSISEEAKDRAKREAWFQWFEITPYEFFCE
EFSAGIPTWALGRKFKNGTDLASPSGLRLPEIRMPLLLGIWGSAFCATLSHYYREIRPLV
KSLTGLQSVDELIWGHNKDLSKVHPIEPASIPNFVHGMYGQLPQAVPQAVYDNEHIQLMD
AGMSNNLPIYPLLRPGRDVDIVVAFDASADIKTDNWLSVVEGYARQRGVKGWPVGIGWPK
PTESPSLAATELEEAQAHSAAEAEGKVTQAKTDQAARHADLPKPSPGTKPLKPEAQRQTA
AASELGYCTVWVGTTEERASEHPPPPPVDDASTWRLTAPDAGITVVYLPLLANERAAPGV
DVAASDYLSTWNFVYTPRQVDAVVGLARANYAEGRARIRATVRAVFERKRKRRLEREARE
EEQAFRRLVRRGVVGGLGEGDHFS
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggccttcatcgcgcgaggatgcaggccgtggattggacttcgttgtcatggccccagt
cccggtttccgctaccacgactcgaggcggtgcttcttttccgcgcgccagcagccccgg
ttgcgggtgcacacttccaagctgatatcggtgacgatcaccagcgtcttgcttgccttc
tggctgtacccggctgatgcgccgcagcataccgactacccggcgaaggtcgcccccggc
gccgaccccggggattgcggagatccagctgccccggacgacgtggaccagagtgcctgg
agcaagttcacccggaacttcgcgggcatctcgctcgtgccatcgacagatgtgctgtct
gagcgggtggccggcttgatgccggactggttcaagctcatgcctggctacgtcaggaag
ctgcagcgcgagctgaacatggcgccggggtcgctggccgccgagatctggcaggaggcg
agcgacccgctcgtccacccggaaatccactactccgcaaaggtccgcgtgtctggggag
ctgtgcgacgaagagaagaccttcctggagaggagaaggaagatgatcgtccccgcgctt
gcgcggtatttggggattgaagagggggatatccatccggacgacgtccctaccattgct
atgtgcggttccggcggcggcctgagggcactggtcgcgggcaccggctctttcctggcc
acggcagaggacgggctcttcgactgcgttacctacgtctcaggggtcagcgggtcctgc
tggctccagtccctctactactcctccgtaacgggcgcgaacttccaccgtgccatcgac
catctgaaggcacgcctcggcacccacattgcctacccgcccgtggcgttcgcgtcgttg
acgtcgtcgcccacaaacaaatacctcttgagcggcgtggtggagaagctcaagggcgat
cccggcgctcagtttggcctcgtcgatgtctacggcatgcttctggcagcaaggttgttg
attcccaagggagaacttggggtcaacgagaaggactttaaactatcgaaccagcgcgaa
tatgtcaagtacgggcagaatcctctgcccatctacactgctgtgcggcacgaaataccg
gagctagactcgccagactacggcggtccaggctccatctcggaggaggcgaaggaccga
gctaagagggaggcatggttccagtggttcgagatcaccccctacgaattcttctgcgag
gaattctccgccggcatccccacctgggccctgggccgtaagttcaagaacggcaccgac
ttggcgtccccgtcaggcttgcgtcttcccgagatccggatgcccttgctcctgggcata
tgggggagtgccttctgtgcgacgctgagccactactaccgcgagatcagacccctcgtc
aagagccttaccggcttgcagtcggtcgacgagctgatctggggtcataacaaggacctc
agcaaagttcatcccatcgaaccggccagcatcccgaatttcgtgcacggcatgtacggt
cagctcccccaggcggttcctcaggccgtttacgacaacgaacacatccaactcatggac
gccggcatgtccaacaaccttcccatctacccactgctccggcccggccgggacgtcgac
atcgtcgtggccttcgacgcctcggccgacatcaagacggacaactggctctccgtcgtc
gaaggctacgcccgccagcgaggcgtcaagggctggcccgtggggatcggctggccgaag
cccaccgaatctccatccctcgccgccaccgagctcgaagaagcccaagcccactcggcc
gccgaagccgagggcaaagtcacgcaagccaaaaccgaccaagcagcccgccacgccgac
ctccccaaacccagccccggcacgaagcccctcaagcccgaagcgcagcgccagaccgcc
gccgcctccgagctgggctactgcacggtgtgggtcggcacgacggaggagcgcgcgtcg
gagcacccgccgccgccgccggtcgacgacgcgagcacgtggcggctgacggcgcccgac
gccggcatcacggtcgtgtacctgccgctgctggccaacgagcgcgcggccccgggcgtc
gacgtcgccgccagcgactacctcagcacgtggaattttgtgtacacgccgcgccaggtc
gacgccgtcgtcggcctcgcccgcgccaactacgccgagggcagggcgcggatccgcgcg
accgtgcgggcggtcttcgagcgcaagaggaagaggcggctcgagagggaggcgcgcgag
gaggagcaggcgtttcggaggctggtcaggcgcggcgttgtgggtgggttgggggagggc
gatcactttagctga

DBGET integrated database retrieval system