KEGG   Thielavia terrestris: THITE_2116280Help
Entry
THITE_2116280     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
ttt  Thielavia terrestris
Pathway
ttt00860  Porphyrin and chlorophyll metabolism
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THITE_2116280
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     THITE_2116280
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     THITE_2116280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_C Sirohm_synth_M Pyr_redox_3 TrkA_N Shikimate_DH LSDAT_prok Urocanase_C ThiF
Motif
Other DBs
NCBI-GeneID: 11520621
NCBI-ProteinID: XP_003653706
JGI: Thite2_2116280
UniProt: G2R180
Position
2:complement(join(9401490..9402167,9402277..9402381))
Genome map
AA seq 260 aa AA seqDB search
MAEASSKFPEVQGGGSLIIAWQIKGKRVLVVGGGEVAAGRILHCLNADANVTVVAPAARL
NPEVAYRVARQQVTHVDRNFEPADLDGADMVLVAIDDPAASTAIWTLCKQRRIPANIADV
PPECDFYFGSVHRDGPLQIMVSTNGKGPRLASLIRRFIADKLPPDTGRAIERVGQLRAEL
RRVAPLPADGPRRMAWMTKVSDAYPWDEMCGLTDEDIANLLTFFPSGTVPSLDVLKGMRA
NPDADVTDVFDGSFGFSVGA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcatcatcgaagtttcccgaggtccagggcggcgggagcctgatcattgcc
tggcagatcaagggcaagcgggtgctggtcgtcggtggcggcgaggtcgccgctggccgc
atcctccactgcctcaatgccgacgccaacgtgaccgtggtggcgcccgccgcccgcctc
aacccggaggtggcctatcgcgtggcccggcagcaggtcacgcacgtggaccgcaacttc
gagccggccgacctcgacggcgccgacatggtgctggtggccatcgacgacccggccgcg
tcgaccgccatctggacgctgtgcaagcagcgccgcatccccgccaacatcgccgacgtg
ccgcccgagtgcgacttctacttcggcagcgtgcaccgcgacggcccgctgcagatcatg
gtcagcaccaacggcaagggcccgcgcctggccagcctgatccgccgcttcatcgccgac
aagctgccgcccgacaccggccgcgccatcgagcgggtcggccagctgcgcgccgagctg
cgccgggtcgccccgctgcccgccgacggcccccggcgcatggcctggatgaccaaggtc
agcgacgcgtacccctgggacgagatgtgcggcctgaccgacgaggacatcgccaacctg
ctcaccttcttcccctccggcaccgtgccgtcgctagacgtgctcaagggcatgcgcgcc
aatcccgacgccgacgtcacggacgtgtttgacggctcctttggcttcagcgtcggtgcg
tga

DBGET integrated database retrieval system