KEGG   Thielavia terrestris: THITE_2116720Help
Entry
THITE_2116720     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ttt  Thielavia terrestris
Pathway
ttt00010  Glycolysis / Gluconeogenesis
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
ttt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2116720
Enzymes [BR:ttt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     THITE_2116720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 11516473
NCBI-ProteinID: XP_003654077
JGI: Thite2_2116720
UniProt: G2R713
Position
3:complement(join(1394114..1394417,1394486..1395716,1395781..1395970))
Genome map
AA seq 574 aa AA seqDB search
MGLDIRERGLKKPVAVAEYLFRRLHEIGIRSVHGLPGDFNLVALDYIPKAGLRWVGSVNE
LNAAYAADGYARIKGISALVTTFGVGELSAINGVAGAFSEHVPVVHIVGCPSTISQRNGM
LLHHTLGNGDFNVFANMGSQIACDTARLNKPAEIADQIDHALRECWIRSRPVYIMLPTDM
VEKKIEGARLDTPIDLTEPENEAEREDYVVDVVLKYLHAAKCPIILVDACAVRHRVLKEV
HDLVEKTQLPVFVTPMGKGAINESHPSYGGVYAGTGSHPDVAERVESADLVLSIGALKSD
FNTTGFSYRTSQLNTIDFHSTYCQVRYSEYPGVAMRGVLRKVVERVDLSKLSQPSSPQVV
NKVAENWDDSETITQAFFWPRIGEYLKENDIVVTETGTANFGIWETKFPPGVTGVTQILW
GSIGWSVGAAQGAALAARDMGVDRRTILFVGDGSFQLTAQEVSTMIRHNLKVTIFLIYNE
GFTIERFIHGMEAEYNNIARWQYTEVPAVFGASDKQCRKFVVKTKDQLEKLLTDKEFNEA
RGLQFVELWLPKEDAPRALRITTEVAARTNARVE
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggggctcgacatcagagaacggggcctcaagaaacccgtcgctgtggccgagtacttg
ttcagaagattgcatgagattggcatccgctccgtccatggccttccgggagacttcaat
ctggtggccctggattacattcctaaggccggcctgcgatgggtcggcagcgtcaacgag
ctgaatgcggcctacgccgctgacggctatgcccgcataaagggcatctcggccctcgtc
accacctttggagtgggagagctgtcggccatcaacggtgtggccggcgccttctccgag
cacgttcccgtcgtgcatatcgtcggctgtccatcgaccatctcgcagcgcaacggcatg
ctgctgcaccacacgctcggcaacggcgacttcaacgtcttcgccaacatgggctcgcag
atcgcctgcgataccgcccggctgaacaagccagccgagatcgccgaccagatcgaccac
gccctgcgcgagtgctggatccgcagcaggcccgtgtacatcatgctgccgaccgacatg
gtcgagaagaagatcgagggcgcacgcctcgacactcccatcgacctgacggagcccgag
aacgaggccgagcgcgaggactacgtcgtggacgtcgtcttgaagtatctccacgccgcc
aagtgccccatcatcctggtggacgcctgcgccgtccgccaccgggtgctcaaggaggtg
cacgacctggtggagaagacgcagctcccggtgtttgtgacgcccatgggcaagggcgcc
atcaacgagagccatccgtcgtacggcggagtgtatgccgggaccggatcgcacccggac
gttgccgaacgggtcgagtcggccgacctggtcctgtcgatcggcgcgctgaagagcgac
ttcaacaccaccggcttctcgtaccggacctcgcagctcaacacgatcgatttccactcg
acctattgccaggtgcgatactccgagtaccccggcgtcgccatgcgcggggtgctccgc
aaagtggtcgagcgcgtcgacctgagcaagctgtcgcagccctcgtcgccacaagtcgtc
aacaaggtggccgagaactgggacgactccgagaccatcacgcaggccttcttctggccc
cgcatcggggagtatctgaaggagaacgacatcgtggtcaccgagacgggcaccgccaac
tttggcatctgggagaccaagttcccgcccggcgtgacgggtgtgacgcagatcctctgg
ggcagcatcggctggtccgtcggtgctgctcagggggccgcgttggctgcgagggacatg
ggcgtcgaccggcggaccatcctgttcgtcggcgacggctcgttccagctgaccgcgcag
gaggtgtcgacaatgatccggcataacttgaaggttactatcttcctcatctacaacgaa
ggtttcaccatcgagcgcttcatccacggcatggaggccgagtacaacaacatcgcgcgg
tggcagtacaccgaggtgccggccgtgttcggtgcgtcggacaagcagtgtcgcaagttt
gtcgtcaagacaaaggaccagctcgagaaactgttgaccgacaaggagttcaacgaggcc
cgggggctgcagtttgtcgagctgtggctgcccaaggaggatgcgccaagggcgctgagg
atcacgaccgaagtggccgcgagaaccaatgcaagggtcgagtaa

DBGET integrated database retrieval system