KEGG   Thielavia terrestris: THITE_2117402Help
Entry
THITE_2117402     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
ttt  Thielavia terrestris
Pathway
ttt00730  Thiamine metabolism
ttt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    THITE_2117402
Enzymes [BR:ttt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     THITE_2117402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 Pyr_redox_2 Lycopene_cycl NAD_binding_9 FAD_binding_2 FAD_oxidored HI0933_like Trp_halogenase Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 11516425
NCBI-ProteinID: XP_003654402
JGI: Thite2_2117402
UniProt: G2R807
Position
3:complement(join(2882778..2882872,2882945..2883658,2883779..2883971))
Genome map
AA seq 333 aa AA seqDB search
MAPTAVSPTQQHAQLAFSAGKKAAVDERAGEGLTKPLADMMGNWENFSFAPIRESTVSRA
MTRRYFADLDQHAESDIVIIGAGSCGLSAAYTLGRLRPDLRITLIEAGVAPGGGAWLGGQ
LFSAMVLRKPADAFLREVGVPYEDEGDFVVVKHAALFTSTVLSKVLAMDNVKLFNATAVE
DLITRPHHDDDDAEGEGGAGVRIAGVVTNWTLVSMHHDDQSCMDPNTINAPVVISTTGHD
GPFGAFSVKRLVSMKQLRQLEGMRGLDMLRAEDAIVRNTREIVPGLIVGGMELSEIDGAN
RMGPTFGAMALSGVKAAEEALRVFDLRKKQNEL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaccgcagtgtctcccacccagcagcacgcccagcttgccttttctgcgggc
aagaaggccgccgtcgatgagcgtgctggcgagggcctgaccaagccgctggccgacatg
atgggcaactgggagaacttctcgttcgctccgatccgagagagcaccgtctctcgcgcc
atgacgcgccgttacttcgccgacctggaccaacacgccgaatccgacatcgtcatcatc
ggcgccggttcgtgcggcctgtcggcggcgtacacgctgggccggctgcggccggacctg
cggatcacgctgatcgaggcgggcgtggcccccggcggcggcgcgtggctgggcgggcag
ctcttcagcgccatggtgctgcgcaagccggccgacgcgttcctgcgcgaggtcggcgtg
ccgtacgaggacgagggcgacttcgtcgtcgtcaagcacgccgccctcttcaccagcacc
gtgttgagcaaggtgctggccatggacaacgtgaagctgttcaacgccacggccgtcgag
gacctgatcacgcggccgcaccacgacgatgacgacgccgagggcgagggcggcgccggc
gtccgcatcgccggcgtggtgaccaactggacgctcgtgtcgatgcaccacgacgaccag
agctgcatggaccccaacacgatcaacgcgcccgtggtgatctcgacgacgggccacgac
gggcccttcggcgccttctcggtcaagcggctcgtcagcatgaagcagctgcgccagctc
gagggcatgcgcgggctggacatgctgcgcgccgaggacgccatcgtcaggaacacgcgc
gagatcgtccccggcctgatcgtcggcggcatggagctgtccgagatcgacggcgcgaac
cgcatgggtcccacgtttggcgccatggcgctcagcggcgtcaaggcggccgaggaggcc
ctccgcgtgttcgacctccgcaagaagcagaacgagctgtga

DBGET integrated database retrieval system