KEGG   Thermothielavioides terrestris: THITE_2117942Help
Entry
THITE_2117942     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
ttt  Thermothielavioides terrestris
Pathway
ttt04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    THITE_2117942
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ttt04131]
    THITE_2117942
Membrane trafficking [BR:ttt04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    THITE_2117942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Clathrin SDA1 Vps39_1 BUD22 zf-RING_5
Motif
Other DBs
NCBI-GeneID: 11518240
NCBI-ProteinID: XP_003654759
JGI: Thite2_2117942
UniProt: G2R690
Position
3:complement(join(4227824..4228816,4228875..4230579,4230634..4231619,4231681..4231707,4231779..4232177))
Genome map
AA seq 1369 aa AA seqDB search
MTETPPLPGDNDPHDGATEPAPGSERVISQGSSTPNPSPSSQLGHLSNSAKEAEDAPGRM
MEQSTDEEDGDDGDDGGDDGEEEEEEEEEEEEDDEEEEDEEPKLKYARLTQHLGPVYRNG
DATSAFLVAGDKMIVGTHNGNIHVVQLPAFQSLRVYHAHSASVTSLSISPFPPPLPASKP
DVAARSVSDSPQRPATATSNSHSSPAATSRRPKEQQVVPNTPSNNIYIATSSTDGNICVQ
SLIDVKDVQLRNFARPVQAVALSPEYKHDRTYLSGGLAGQLILTVGAPNGRSTAMTTGAT
AHAAGWLGGMVGAGTGRDTVLHSGEGTINTIKWSLSGRYVVWLNEHGIKIMRTKLHLDNA
DAEDAWKRIGHIDRPQTDEWETMASVWKGRAEWIDEQAVEHDEVAAEHREAVLSPAAESL
KRQQLKNGKKAERLLVGWGGTIWIIHVHPGGIGAGKNAGERSAGRAEIVKILRMDCIISG
ISLYTQNLLLVLAYCLPDEEEEDNEASEPSRGHRHALSESSTGSGPSGGIQRKQNRQPPE
LRLIDLSSQAEVDKDGLTVSRFERLSSNDYHLGILPAQNAAAAASSKGALEALAGLGTDV
LNAALNPMSLFSSAASVMSKGSDGASASNVPPSAARSGGASVHPHLLKPGVKIFIHSPYD
CILATRRDLSDHLAWLLDHNQYQEAWTLVDQHPEIMSAAPDATPTSPQHTQTTDDFYDET
ASVAEGMRSFNSAAEKEKRRIGELWIQDLIEAGDWALAGQICGKVVATPDRWEKWVWTFA
GANKFDEIVNYIPSERTRPPMRGTLYEVMLGHYLQVSKPRFRDLLDRWSPDLYDVSAITS
ALQDQLMYRDVREDSVEDGEVGRDWRIVMESLAKLHEASGRTREALRCHIKLQDADSAMR
LIKEGHLADAVADDIPSFISLRVPQDHAAKMSRAELEQATAEAITLLVDEAQHGLVKPDV
VVAQLQDKKLDLYTFFYLRGLWRGEGMHEHPGETQARLVTDSQSLVDQFADLAVHLFAIF
DQSLLMEFLKTSTAYAFEKAAQECEAHNYVPELVYLYSKTGQTKRALYLIIDRLADVSRA
IAFAKEQDDPDLWEDLLTYSMDKPRFIRALLEEVGTAIDPITLVRRIPEGLEIEGLREGL
KHIMKEHEIQHSICEGAARVLRSEVAAAQALLRSGQRRGVKFEVVPAPKAGSSTKPPTFA
GTAAPASGHADPPPAAKDKTKSSATTNGEAAYPSGTTPSSNTPTTSTAAAAADPKEAAPK
KWTPGHCADCLAPFCPWETETLVGFACGHVFHLSHLLQRLHAPGGGGEEVDRLATLSGVG
IGVAGEEPSAAAAAAAAHLVGPKVAHARLLRDRVAGGCPVCVSGEKGGR
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaccccgccactgcctggcgacaacgatccgcacgatggggccacagaacca
gcgcccggcagcgaacgcgtgatcagccaaggcagcagcacgccaaacccgagcccgtcc
tcccagcttggacatctctcgaatagcgccaaggaagctgaagatgcaccgggcagaatg
atggagcagtcgacggacgaagaggatggcgatgacggcgacgacggtggcgacgacggg
gaggaggaagaagaggaggaggaggaagaggaggaagacgacgaagaggaggaggacgaa
gagccgaagctcaagtacgcgcgcttgacccaacacctcgggcctgtctaccgaaatggc
gatgcgaccagcgcctttcttgtcgcaggggacaagatgattgttgggactcacaatggc
aacatccacgtcgtccagctaccagcattccagtctttgcgagtctaccacgcccactcc
gcctccgtcacctcgctgtcgatatccccgtttccgcctccactccctgcctccaaacct
gacgtggctgccagatcggtttctgacagtcctcaacgaccagccacggccacgagcaac
agccattcctcgccagctgccacctcccgaagaccgaaagagcagcaggtcgtgccgaac
acaccgtcgaataatatctacatcgccacgtcctccacggatggcaacatctgcgtgcag
tcgctgattgacgtcaaggacgtgcagttgcggaactttgcccgccccgtgcaggccgtc
gccctgtcgcccgagtacaagcacgaccggacgtatctgtcgggcggactggcgggccag
ctcatcctgaccgtcggtgcgccaaatggccggagcacggccatgaccacaggtgccacc
gcacatgcggctggctggctgggcggcatggttggagccggcaccgggagggacaccgtc
ttgcactcgggcgaggggaccatcaacaccatcaaatggtccctctcggggcgctacgtg
gtctggctcaatgaacacggcatcaagatcatgcgcacaaagctccatctcgacaacgcc
gacgccgaagatgcctggaagcggataggccatatcgacaggcctcagacagacgagtgg
gagaccatggccagtgtgtggaaggggcgggcggagtggatagacgagcaggcggttgag
cacgacgaggttgccgccgaacaccgcgaggccgtgctgtctccagcggctgagagcctg
aagcggcaacagctcaagaatggcaagaaggccgagcgacttctcgtggggtggggtggc
accatttggatcatccacgtccaccccggcggcatcggtgcgggcaagaacgctggggag
aggtccgctgggcgggcggagattgtaaagatactgcggatggattgcatcatttccggc
atttcgttatatacccagaaccttttgttggttcttgcttactgcttgcccgacgaggag
gaagaggacaacgaagccagcgagccatctcgaggccacaggcatgcgctatctgagagc
tctaccgggagcgggccttccggagggatccagcgaaagcagaacaggcagccgcccgaa
ctgagactcatcgatttgtcgtcgcaggccgaggtggacaaggacggattgacagtcagc
cgctttgagaggttatcatcgaacgactatcacctcggcatcctgcccgcccaaaacgcc
gctgccgcggcatcatccaaaggcgccctggaggcgctcgcagggctaggcactgacgtc
ctaaacgctgccctgaaccccatgtcactattcagctccgccgcaagcgtcatgagcaaa
ggcagcgatggcgcctcggcctccaacgtgcctccttcggcggcccggtcaggcggtgcc
tcggtccacccgcatctgctcaagccaggggtcaaaatcttcatccacagcccgtatgac
tgcatcctggctaccaggcgcgacctcagcgaccacctggcatggctcctagaccacaat
caataccaagaagcatggacgctagtcgaccagcatcccgagatcatgtcggcggctccc
gatgccacgccgacatcgccgcaacacacgcaaaccaccgacgacttctatgacgagact
gcgtcggtcgccgaaggcatgcggtccttcaactcagctgcagagaaagagaagcggcgg
attggcgagctgtggatacaagatctcatcgaggctggcgactgggctctggccgggcag
atatgtggaaaggtcgtcgccacgcccgaccgttgggagaaatgggtgtggacgttcgcc
ggtgcgaacaagttcgacgagattgtcaactacatacccagcgaacgcacgcggcccccc
atgcgaggcaccctctacgaggtcatgctcgggcactacctgcaggttagcaaaccccga
tttcgagacctgctggatcggtggtcgcccgacctgtacgacgtgagtgccatcacgtcg
gctctgcaggaccagctcatgtaccgagacgtgcgggaggatagtgtcgaggacggagag
gtcggccgggactggcggatcgtcatggagagcttggccaagctgcacgaggcgagcggc
aggaccagggaggcgttgaggtgtcacatcaagctgcaagatgccgactcagcaatgcgg
ctgatcaaggagggccacctcgcagacgccgtagctgacgacatcccgagcttcatcagc
ctgcgcgtccctcaagaccacgccgcgaagatgagccgcgcagaattggagcaggccact
gccgaggccatcactttactggtagacgaggcacagcacggactggtaaagccggacgtt
gtcgtcgcgcaactgcaggacaaaaagctggatctgtacacgttcttctacctcaggggt
ctctggcggggagagggcatgcacgagcacccgggcgagacacaagctcgcctcgtaacc
gacagccagtcgctggttgaccagtttgccgaccttgctgtccatctcttcgccattttc
gatcaatccctgttgatggaattcctcaagacctcgaccgcgtatgcattcgaaaaggca
gcgcaagaatgcgaagcgcacaactacgtccccgagcttgtctacctctactccaagacc
ggccagaccaaacgggcgctttatctcatcatcgaccgcctcgccgacgtcagccgcgcc
atcgccttcgccaaggagcaggacgacccggacctctgggaggacctgctcacgtacagc
atggacaagccgcgcttcatccgcgcgctgctcgaggaggtcggcacggcgatcgacccc
atcacgctggtgcggcgcatccccgagggcctggagatcgagggcctgcgcgagggactc
aagcacatcatgaaggagcacgagatccagcacagcatctgtgaaggtgcggcgcgcgtg
ctgcgcagcgaggtggccgccgcgcaggcgcttctgcggagcgggcagcgcaggggcgtc
aagttcgaggtcgtgccggcgccgaaagccgggagcagcaccaagccgcccaccttcgcc
ggtactgctgcccccgcctccgggcatgcagacccgccgccggcagccaaggacaaaacg
aagtcttcggctaccacaaatggcgaggccgcctacccatccggcacaaccccctcttcc
aacacccccaccaccagcaccgccgccgctgccgccgaccccaaagaagcagcacccaag
aagtggacgccgggccactgcgcggactgcctcgcgccgttctgcccctgggagaccgag
acgctcgtcggcttcgcctgcggccacgtcttccacctgagccacctgctgcagcggctg
cacgcaccgggcggcggcggcgaggaggtcgaccgtttggcaacgctgagcggcgtcggc
atcggcgtcgcgggggaagagccgagcgcggcggcggccgccgccgcggcgcaccttgtc
ggccccaaggttgcgcatgcgcggctgctgcgcgatcgggttgctggtggctgtccggtt
tgtgtgagcggggagaaagggggtcggtga

DBGET integrated database retrieval system