KEGG   Thielavia terrestris: THITE_2118012Help
Entry
THITE_2118012     CDS       T02228                                 

Definition
(RefSeq) glycoside hydrolase family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ttt  Thielavia terrestris
Pathway
ttt00052  Galactose metabolism
ttt00500  Starch and sucrose metabolism
ttt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    THITE_2118012
   00500 Starch and sucrose metabolism
    THITE_2118012
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     THITE_2118012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR_2 BNR
Motif
Other DBs
NCBI-GeneID: 11518818
NCBI-ProteinID: XP_003654801
JGI: Thite2_2118012
UniProt: G2R6I4
Position
3:complement(join(4396229..4397889,4397965..4398082))
Genome map
AA seq 592 aa AA seqDB search
MGHSTSRRPRFHFTANSWINDPCAPGYDPNTKTYHLFYQCNPSGCEWGNMSWGHIVSQDM
LCWTPADPSPALLPDQAYDAQGVFTGCWIPPANESDGTLRVAYSSVRQLPFHWSTPPYPR
SAAGLAIALSRDGGKTWTKSARNPVVAGEPAGVAVTGFRDPFVTELPLIPCDAERRSSES
GRGPVLYGLVSGGIQDRGPTVFLYEIRRDDPEEEWRCLGPLVDLPARFQPSPKWSGNYGV
NWECANLVALRAESEVRHFLILGAEGDVEKDHVRSYERSVTAAAAPSRTVRAQLWMSGRL
VASGDGGVRFQYEHGGYLDHGPYYAANSFTDPRTGRTIVYGWIPEEDLPLGAAAEKGWNG
SLAVPREIFLLRIPRVVGALRSSLRDISPFVLRPEPDGDTTTFTVLTLGVRPVAELAQLR
EASHHQHSATDIALPESNSITRRGICHTRSTSWELAATVAIGAGCQDVGFHLRHNVDLST
CTTVTFSAATETIVVDRHASNTDPAVNKCPDAGPFTLLTTRDADGTESIEKLRIRILSDG
DILEVFANDRFALATMVYSGSGQDLGGVTAFATGSAGSAVFETITVWDGLEL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgggacactcgacgtcacggcgacccaggttccacttcactgcaaacagctggatcaac
gacccatgcgctcctggctacgatccgaacaccaagacgtatcatctcttctaccaatgc
aacccgtccggatgcgaatggggcaacatgtcctggggacacatcgtgtcccaggacatg
ctgtgctggacgccagccgacccgtccccggcgctcctcccggaccaagcatacgacgcc
caaggggtgttcaccggctgctggatccctcccgccaacgagtcggacggtaccttgcgg
gttgcgtactcgtcggtcagacaactgcccttccactggagcacgccgccgtacccgcgc
agcgcagcgggcttggccatcgcgctgtctcgcgacggcggcaagacgtggacgaaatcg
gcgcgcaaccccgtcgtggctggcgagccggccggcgtggccgtcaccgggtttcgggat
ccgttcgtgacggagttgcctctgattccctgcgacgccgagcgcaggtcctcggagagt
gggagggggccggtactctacgggctcgtctcgggcggcatacaagaccgcgggccgacc
gtgtttctgtacgagatccgtcgcgacgatcctgaagaggagtggagatgccttggtccc
ttggtcgacctgcccgcgcggttccagccgtcgccgaagtggagtggcaactacggcgtc
aactgggagtgtgccaacctggtggcgctgcgggccgagtcggaggtccgacactttctg
attctgggcgccgaaggagacgtcgagaaggatcatgtgcgctcttatgagcgctccgtc
acggccgcggcggcgccgtcgcggacggtgagggctcagctgtggatgtcgggccgcctt
gttgccagcggcgacggcggtgttcgattccaatacgaacacgggggatacctcgaccac
ggaccgtactacgccgcgaactcgttcacggacccccggactggtcggacgattgtgtac
ggctggattccagaggaagacctgcccctgggcgccgctgcggaaaagggctggaacggt
tctcttgcggtccctcgcgagatcttcctcctccggatcccacgagtcgtcggcgccctg
cggagctccctgcgggacatctctcccttcgtgctcaggccggagccggacggggacaca
actaccttcaccgtcttgacgttgggcgtgaggccggtcgcggaactggcgcagctgcgt
gaggccagccatcatcagcacagtgcaaccgacatcgccttgccggagtccaactcgatc
acgaggcgaggcatctgccacacccgctctacaagttgggagctcgcggccaccgtcgcg
atcggcgcgggatgtcaagacgttggcttccacctgcgccacaacgtagatctgtccaca
tgtaccacggtgacattctcggccgcgaccgagaccatcgttgtcgaccgtcacgcctcg
aacaccgacccggcggtcaacaagtgtccggacgccggtcccttcaccctccttacaaca
cgggacgccgatggaacagagagcatagagaaacttcgtattcggatcttgtcggatgga
gacatcctcgaggtattcgcaaacgaccgttttgcgctcgcgaccatggtgtactcgggc
tccgggcaagacttgggaggggtgacggccttcgcgacgggaagcgcgggcagcgccgtg
tttgagacgatcacggtatgggatgggctggagctgtaa

DBGET integrated database retrieval system