KEGG   Thielavia terrestris: THITE_2118655Help
Entry
THITE_2118655     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttt  Thielavia terrestris
Pathway
ttt00010  Glycolysis / Gluconeogenesis
ttt00051  Fructose and mannose metabolism
ttt00562  Inositol phosphate metabolism
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
ttt01130  Biosynthesis of antibiotics
ttt01200  Carbon metabolism
ttt01230  Biosynthesis of amino acids
Module
ttt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ttt_M00002  Glycolysis, core module involving three-carbon compounds
ttt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2118655
   00051 Fructose and mannose metabolism
    THITE_2118655
   00562 Inositol phosphate metabolism
    THITE_2118655
Enzymes [BR:ttt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     THITE_2118655
Exosome [BR:ttt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   THITE_2118655
  Exosomal proteins of bladder cancer cells
   THITE_2118655
  Exosomal proteins of melanoma cells
   THITE_2118655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 11524059
NCBI-ProteinID: XP_003655217
JGI: Thite2_2118655
UniProt: G2RAK3
Position
4:complement(join(1246237..1246265,1246339..1246956,1247048..1247118,1247226..1247263))
Genome map
AA seq 251 aa AA seqDB search
MARKFFVGGNFKMNGTKESIKSIIENLNKASLDPNVEVVIAPPALYLQLARDTVDKASGV
EVAAQNVYHKPNGAYTGEISVAQLKDSDIHWTILGHSERRTLLGETDELVASKTKAAVEG
GVSVIWCCGESLEEREAGNTVAVVERQLAALAAKLSAADWKKIVIAYEPIWAIGTGKVAT
VQQAQEVHEAIRKWLRTQFGDAVADETRILYGGSVNGKNCKDLAKEKDIDGFLVGGASLK
PEFVDIINSNQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcaagttcttcgttggcggcaacttcaagatgaacgggaccaaggagtccatc
aagagcatcattgagaacttgaacaaggccagcttggatcccaacgtcgaggtcgtgatc
gcccccccagcgctgtacctccagctcgcgcgggacacggtcgacaaggcgtccggcgtc
gaggtggcggcgcagaacgtctaccacaagcccaacggcgcctacacgggcgagatcagc
gtggcccaactcaaggacagcgacatccactggaccatcctgggccactcggagcggcgg
acgctgctgggcgagacggacgagctggtggcgtccaagaccaaggccgccgtcgagggc
ggcgtcagcgtcatctggtgctgcggcgagtcgctcgaggagcgcgaggccggcaacacg
gtcgcggtcgtcgagcgccagctggccgccctcgccgccaagctctcggccgccgactgg
aagaagatcgtgatcgcctacgagcccatctgggccatcggcaccggcaaggtcgccacc
gtccagcaggcccaggaggtgcacgaggccatccgcaagtggctcaggacccagttcggc
gacgcggtcgccgacgagacccggatcctctacggtggcagcgtcaacggcaagaactgc
aaggaccttgccaaggagaaggacattgacggtttcctggttggcggtgccagcctgaag
cccgagttcgtcgacatcatcaactccaaccagtga

DBGET integrated database retrieval system