KEGG   Thermothielavioides terrestris: THITE_2124801Help
Entry
THITE_2124801     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
ttt  Thermothielavioides terrestris
Brite
KEGG Orthology (KO) [BR:ttt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ttt03041]
    THITE_2124801
   03009 Ribosome biogenesis [BR:ttt03009]
    THITE_2124801
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     THITE_2124801
Spliceosome [BR:ttt03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    THITE_2124801
Ribosome biogenesis [BR:ttt03009]
 Eukaryotic type
  90S particles
   Helicases
    THITE_2124801
  Pre-60S particles
    THITE_2124801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII MITF_TFEB_C_3_N
Motif
Other DBs
NCBI-GeneID: 11523361
NCBI-ProteinID: XP_003658251
JGI: Thite2_2124801
UniProt: G2RGT0
Position
6:complement(join(3364168..3364296,3364360..3365249,3365310..3365408,3365477..3366143))
Genome map
AA seq 594 aa AA seqDB search
MASDLSKKRKFKDAKGSKPEEALAAASKAKKLKRDPSPEESDTESDADSDAESRSDSSRG
ADDQEPEAEGASSGEDSSDRESARQDDGDDDQQNGSAELDAVPSKGGDSLLPPPVSTNAQ
EFSELGLSEKTMKAIAEMGFTKMTEIQRRGIPPLLAGKDVLGAAKTGSGKTLAFLIPAVE
MLSSLRFKPRNGTGAIVVTPTRELALQIFGVARELMKNHSQTYGVVIGGANRRAEADKLG
KGVNLLIATPGRLLDHLQNTPFVFKNLRSLIIDEADRILEIGFEDEMRQIVKILPKENRQ
TMLFSATQTTKVEDLARISLRPGPLYINVDEEKKFSTVDGLDQGYVVVEADKRFLLLFSF
LKKMAKKKIIVFFSSCNSVKYYSELLQYIDLPVLDLHGKQKQQKRTNTFFEFCNAKQGTL
ICTDVAARGLDIPQVDWIVQFDPPDDPRDYIHRVGRTARGNNSKGRSLLFLQPSELGFLA
HLKAAKVPVVEYDFPKNKILNVQSHLEKLIGTNYYLNQSAKDGYRSYLHAYASHSLRSVF
DIHKLDLVKVAKSFGFATPPRVDITLSAGLSRDKKLQRRRAYGSQPRQGGHHRK
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgatctcagcaagaagaggaaattcaaggacgccaagggctcaaagcccgag
gaagctctcgccgctgcctcgaaggcaaagaagctgaagagggaccccagcccagaagag
agcgacaccgagagcgacgctgacagcgacgccgagagccgcagcgacagctcccgcggg
gccgacgaccaggagcccgaggccgaaggcgccagctcaggcgaggatagttctgaccgc
gaatcggccaggcaggatgatggggatgacgatcagcaaaatgggtcggcagaattggat
gcagtcccttccaagggcggcgactcgttgcttccgcctcccgtgtcgacaaatgcgcag
gaattctccgagctcggcctctccgagaagaccatgaaagcgatcgccgagatgggtttc
acaaagatgactgagatccagcggcgaggcatcccgcccctcctggcgggcaaggatgtc
ctcggggcggccaagactggatccgggaagacgctggccttcctgattccggccgtcgag
atgctcagttctctgcgcttcaagccgagaaatggtactggtgccatcgttgtcacgcct
acgcgcgagctggcgctgcagatcttcggcgtggcccgcgagttgatgaagaatcactcc
cagacctatggtgttgtcattggtggtgcgaatcgcagggccgaggcggacaaacttggc
aagggcgtcaacctcctcattgccacgcctggcagactccttgatcaccttcaaaacacc
ccatttgtcttcaagaacctaaggtccctgatcatcgacgaggccgaccggatattagag
attggtttcgaggacgaaatgcgccagattgtcaagattctccccaaagaaaaccgccag
accatgcttttctcggccacgcagacgacaaaggtcgaggatctcgccagaatttcgctg
cgccccgggccactctacatcaacgtcgacgaggagaagaagttcagcacggtcgatggt
cttgatcaaggatacgtcgtcgtcgaagccgacaagcgcttcctcctgctcttctcgttc
ctcaagaagatggccaagaagaagatcatcgtgttcttctcgtcctgcaattcggtcaag
tactacagcgagcttctccagtacattgatctgccggttctcgacctgcacggcaagcag
aagcagcagaagcgcaccaacaccttcttcgagttctgcaacgccaaacaggggacgctg
atctgcaccgacgttgccgcccgtggcctcgacatcccccaggttgactggatcgtccag
ttcgatccccctgatgacccgcgagactacatccaccgggtcggccggacggcgagaggc
aacaattccaagggtcggtcgctgctcttcctgcagccgagcgagcttggttttctggcc
cacctcaaagccgccaaggtgccggtggtcgagtacgacttcccaaagaacaagatactc
aacgtgcaatcgcatttggaaaagctcatcgggaccaactactacctcaaccagagcgcc
aaggatggctaccggtcttacctgcacgcctatgcctcccacagccttcggagtgtcttt
gatatccacaagcttgacttggtgaaggtggccaagagctttggcttcgccacgccaccc
cgagtcgacatcacgctgtccgcagggttgagccgggacaagaagctacagcgcaggagg
gcatacggcagccagccacggcagggcggccaccaccggaagtaa

DBGET integrated database retrieval system