KEGG   Teredinibacter turnerae: TERTU_0923
Entry
TERTU_0923        CDS       T00952                                 

Definition
(GenBank) ribosomal protein L6
  KO
K02933  large subunit ribosomal protein L6
Organism
ttu  Teredinibacter turnerae
Pathway
ttu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    TERTU_0923
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ttu03011]
    TERTU_0923
Ribosome [BR:ttu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    TERTU_0923
  Bacteria
    TERTU_0923
  Archaea
    TERTU_0923
SSDB
Motif
Pfam: Ribosomal_L6
Other DBs
NCBI-ProteinID: ACR13861
UniProt: C5BQ76
Position
968642..969175
AA seq 177 aa
MSRVANSPVQLPSGVELKQNGQDVTVKGGKGQLAIQIHDSVELKIEENVVTFAARDGAKA
SRAMAGTMRALVNNMVTGVSQGFEKKLVLNGVGYRAKAAGSTLNLTLGFSHPIDYDLPEG
VTAETPTQTEILLKSANKQLLGQVASEVRAFRPPEPYKGKGVRYADEFVRRKEAKKK
NT seq 534 nt   +upstreamnt  +downstreamnt
atgtctcgcgttgcaaacagtccagttcaactgcccagcggtgttgaattaaagcaaaac
ggtcaggatgtcactgtaaaaggtggtaaaggccagttggcgattcagatccacgatagc
gttgagctgaaaattgaagaaaacgtagttacgtttgccgctcgtgatggagccaaagct
tctcgtgcgatggctggtaccatgcgtgccctggtaaacaatatggtcactggcgtaagc
cagggctttgagaaaaaacttgtcctgaacggcgttggttaccgtgctaaagcagccggt
agtacgttgaatctgacactgggtttttctcacccaatcgattacgacctgccagaaggc
gtaactgcagaaactcccacgcaaaccgaaatcttgctgaagagtgcaaataagcagttg
ctagggcaggttgctagcgaagtgcgtgctttccgtccgccagagccttacaaaggtaag
ggtgtgcgttacgctgacgaatttgtacgtcgtaaagaagctaagaagaagtaa

DBGET integrated database retrieval system