KEGG   Teredinibacter turnerae: TERTU_1262
Entry
TERTU_1262        CDS       T00952                                 

Definition
(GenBank) aromatic ring-opening dioxygenase, catalytic LigB subunit family protein
  KO
K15755  2'-aminobiphenyl-2,3-diol 1,2-dioxygenase, large subunit [EC:1.13.11.-]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00621  Dioxin degradation
ttu01100  Metabolic pathways
ttu01120  Microbial metabolism in diverse environments
ttu01220  Degradation of aromatic compounds
Module
ttu_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    TERTU_1262
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     TERTU_1262
SSDB
Motif
Pfam: LigB
Other DBs
NCBI-ProteinID: ACR11988
UniProt: C5BRV0
Position
1318599..1319414
AA seq 271 aa
MGKLVCAAAMSHVLGTPKDIEEQAERVFQGMREIGRAIRDSSPDVLVVISSDHLNNFNLG
DPKPLAIATAASLQPYGDMGIPTELIRGHSEFAVGFADFVARSNSGLTLAQVDDVRPDHG
VMIPLAITDPQRSIPVVPLYINTVYSDSPTPTECWQLGKLLQQYVSKHRAAEERIAILAC
GGLSHWLGVPEEGHVNEDWDRNFMRQLLGEVPCRVNTLTNKEILSQAGNGGLEVNAWITL
AAALPRLQGEVVFYEAIPLWASGMAGVQFTV
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggaaagttagtgtgtgctgcggcgatgtcgcacgtattgggtacgccaaaagatatt
gaagaacaggcggaacgggtttttcaggggatgcgtgaaattggtcgcgctattcgcgac
agctcacccgatgtactggttgtaattagcagtgatcatctcaacaattttaaccttggc
gaccccaagccactggctattgcgacagctgcgtcgctgcagccttatggcgacatggga
attcccacggaattaattcgtggccattccgagtttgccgtaggttttgccgattttgtt
gcacgtagcaacagtgggctgacgcttgcacaggtggatgatgtcaggccagatcacggg
gtcatgattcccttagctattaccgatccgcagcggagtattccggtggtgccgctttat
atcaatacggtgtattcggattcacccacacccacagagtgttggcagttgggtaaactc
ttgcaacagtatgtaagcaaacatcgagcggcagaggagcgtattgcgatacttgcctgt
ggtggtttgtcgcactggcttggtgtgcccgaggaagggcacgtaaacgaagactgggac
agaaatttcatgcggcaattgctaggcgaggtcccctgccgggtcaacacgctgaccaac
aaagagatactttcgcaagcgggtaatggtggactggaagttaacgcttggatcaccctg
gccgccgcgctgccccggctccagggtgaggttgttttttatgaagccataccgctttgg
gcgagtggcatggccggcgttcagtttactgtgtaa

DBGET integrated database retrieval system