KEGG   Teredinibacter turnerae: TERTU_1282Help
Entry
TERTU_1282        CDS       T00952                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00362  Benzoate degradation
ttu00620  Pyruvate metabolism
ttu00621  Dioxin degradation
ttu00622  Xylene degradation
ttu00650  Butanoate metabolism
ttu01100  Metabolic pathways
ttu01120  Microbial metabolism in diverse environments
ttu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TERTU_1282
   00650 Butanoate metabolism
    TERTU_1282
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TERTU_1282
   00622 Xylene degradation
    TERTU_1282
   00621 Dioxin degradation
    TERTU_1282
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     TERTU_1282
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     TERTU_1282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACR14193
UniProt: C5BRW5
Position
1335902..1336810
Genome map
AA seq 302 aa AA seqDB search
MSKKLRAVIIGPGNIGTDLLMKAQRSAWIEPVWMVGIVESEGIKRAQEMGVKTSITGVDG
ILPYIEQDDIRIAFDATSAYAHKDNAEKLNAAGVIMIDLTPAALGPFCVPPVNLADHAAS
LAMNVNMVTCGGQATIPIVAAVSSVQPVAYGEIVATVSSKSVGPGTRKNIDEFTRTTAKA
IEQVGGAARGKAIIIINPAEPPLLMRDTVHCITQHEPDREAIIRAVLEQVAEVQKYVPGY
RVKNGPVFDGNRVSVYLEVEGLGDFLPKYAGNLDIMTAAGLRTAELFAEQVANQKLQLPA
RG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaactgagagcggtcatcattgggccggggaatattggcaccgatctgcta
atgaaagcgcaacgcagtgcgtggattgagcctgtctggatggttggtattgtcgagtcg
gaaggtatcaagcgcgcgcaggaaatgggtgtgaaaacctctatcactggtgtcgacggc
atattgccgtacattgagcaagacgatattcggatcgccttcgatgccacatccgcctac
gcccacaaggacaatgcggaaaaactcaatgctgccggtgtaattatgatcgacctcact
cctgcagcattaggcccgttctgtgttcctccggtgaacctcgccgaccatgctgcgagc
ctggctatgaatgtcaacatggtgacctgtggtggccaggcgacaatccctatagttgcg
gcagtgtcatcggtgcaaccggtagcgtatggcgaaattgtggcgaccgtcagctctaaa
tctgttggcccgggcacccgcaaaaatattgatgaattcacgcgcaccaccgccaaggcc
atagagcaggtgggcggcgctgcgcgaggcaaagccatcatcattatcaatcccgccgag
ccaccgttgctaatgcgcgataccgtacattgcataacccaacacgagccggaccgcgag
gcgattatccgcgcagtgctagagcaggtagcggaagtccaaaagtatgtgccgggatac
cgcgtaaaaaatggcccggtattcgacggcaaccgggtatcggtgtacctcgaagtggaa
ggtttgggcgatttcctgcccaaatatgcaggtaacctcgacatcatgaccgctgctggc
ctgcgcaccgcagaattgtttgctgagcaggtcgccaaccaaaaactgcaactacccgcg
cgtggctaa

DBGET integrated database retrieval system