KEGG   Teredinibacter turnerae: TERTU_1639Help
Entry
TERTU_1639        CDS       T00952                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ttu  Teredinibacter turnerae
Pathway
ttu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TERTU_1639
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ttu02044]
    TERTU_1639
Secretion system [BR:ttu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TERTU_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP MlrC_C
Motif
Other DBs
NCBI-ProteinID: ACR13452
UniProt: C5BTY8
Position
1689583..1690065
Genome map
AA seq 160 aa AA seqDB search
MAIYIEWEGIEGNVTADGYAKHMSVDTFSFGVGRSITMEVGNCANREANRPAFSEITLTK
LADNSCTSIFQEATSVSEGKKVVIKFVQTGSDKVTEFMTYTLTECLVSGYSVSANSEGDP
LESITVSFCGIEVNYLDFDATNKSASPQRVGYDLKAAKPQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcaatttacattgagtgggaaggcattgaaggtaatgtaactgcagacggttacgca
aagcatatgtctgtagacacatttagcttcggtgttggtcgttcaattaccatggaagtt
ggtaattgcgcgaaccgtgaagctaaccgaccagctttcagcgaaatcactctaaccaag
ctggccgacaactcatgcacttcaattttccaggaagccacaagtgtttctgaaggcaaa
aaagtcgtaatcaagtttgttcaaaccggttctgacaaggtcactgagtttatgacctac
acactgactgagtgtttggttagcggttacagcgtttctgcgaactcagaaggcgaccct
ctcgaaagcatcaccgttagtttctgtggtatcgaggttaactatctcgactttgacgca
accaataagagcgcaagcccacagcgtgttggttacgatcttaaggctgccaagccccag
taa

DBGET integrated database retrieval system