KEGG   Teredinibacter turnerae: TERTU_1651Help
Entry
TERTU_1651        CDS       T00952                                 

Gene name
vasA
Definition
(GenBank) type VI secretion protein, VC_A0110 family
  KO
K11896  type VI secretion system protein ImpG
Organism
ttu  Teredinibacter turnerae
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ttu02044]
    TERTU_1651 (vasA)
Secretion system [BR:ttu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TERTU_1651 (vasA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ACR11163
UniProt: C5BU00
Position
complement(1704648..1706483)
Genome map
AA seq 611 aa AA seqDB search
MSDELLPYYEKELAFIRQMGAEFSRENPKIAGRLGINADTIEDPHVSRLIEAFAYLNART
QHKLDDDFPELTDALLNVMFPHYLRPIPSMSIVTFEPDEDQLDSKYTVDRNTELETEYFQ
GENCRFTTAYPVDMYPLKITSANLIGRPFLTPGAEKMASCAGVLKISLETFNNDINIQEI
GLDKLRLYLRGQPQHVHPLYRMLLKECQKIALGGCTDELHPTFMESSHIQAVGFGEDEGL
LPYPPNSFLGYRLLTEYFAFAEKFMFIDICNLGEHLPASAQNQLDIYLYLTNSEVELEHN
INIDTFVLGATPIINTFKHKCDPIKLNHNHAEYLLLADSRRPKGYEIQAVDEVIASTSSG
EKAPFLPFYGIKHEHKDPTEHAYWYATRRPARSGFAERDDGTDVYISLVDLEFNPNIPDD
RTLTISAICSNRDLPRKLPFGVDQPRLQCAHSSPPTKAIRCLLRPTATIRPPLRDGARWR
LLSHLNLNHLSLIGGSKATEALKEILRLYDFTETSVSRALVDSIMQVNAHAISAPLPING
HTTMCRGVEIEITLDNALLTGSSSYLYASVLEHFFAAYCSVNSFTRVLVKLKNREDYLKK
CPPRAGQKVFL
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgaattgttgccctactatgaaaaagaactcgctttcattcgccaaatgggg
gccgagttttcacgtgaaaacccaaaaattgcggggcgcttgggcattaatgcggatacc
attgaagacccacatgtatcacgattaatcgaagcatttgcctaccttaatgcgcgcacc
caacacaagcttgacgacgactttcctgaactaactgacgctcttctcaatgtgatgttt
cctcactacctgcgtccgattccttccatgtcgattgtcaccttcgagccggacgaagat
cagttagatagcaaatatacggtagatcgaaacaccgagttagagacagaatattttcag
ggcgaaaactgtcggttcaccactgcatatccggtggatatgtacccccttaaaattacc
tcagcaaatcttattggcagaccatttttgactcccggcgctgaaaaaatggcaagctgt
gcaggcgtactaaaaatcagcctggaaacgtttaataatgacattaatatccaagagatt
gggctcgacaaattgcgtctctatctgcgaggccagccgcagcatgttcatccgctctac
cgaatgctgctaaaagaatgtcagaaaatcgcactggggggttgcactgatgagcttcac
ccgacgtttatggaaagcagccacatccaagccgtaggatttggggaagatgaaggacta
ttgccatacccacctaattctttcctgggctaccggctattgacggaatattttgcattt
gccgaaaaatttatgttcatcgatatatgtaatcttggtgaacacctgccggcttctgcc
cagaatcagctggatatttatttgtacctcaccaatagcgaagtcgagcttgaacacaat
attaacatcgacactttcgtacttggtgcgacgccgatcataaacacgtttaagcacaaa
tgcgatccaataaagctcaaccacaaccatgcggaatacctattactggcggattcacgg
cgcccgaaaggctatgaaatacaagcggtggacgaagtaatcgcctccacttcgagcggc
gaaaaggctccatttctgcctttttacggaatcaagcatgaacataaagacccgacggaa
catgcctattggtatgccacacgccgacccgcgagatcaggttttgccgaaagagatgac
ggtacagatgtttacataagcctggtggatctggaatttaaccccaacatcccggacgac
agaacacttacgataagtgcgatctgtagcaaccgggacctaccgcgaaaattgccgttc
ggcgtagaccaacctcgtctgcaatgcgcacatagctcaccacccactaaggccatacgc
tgcttgttacgcccaacggcaactatccgaccaccacttcgagatggtgcccgttggcga
ttactatcacatttaaatttaaatcacttatcgttaattggcggatcaaaagcgacagag
gctttaaaagagattttaagactatacgacttcacagaaacgtcagtgtcacgcgcgttg
gttgattcaatcatgcaagtcaatgctcatgcgatcagcgcgccactgcctatcaacgga
cataccactatgtgccgaggcgttgaaattgaaattaccttggacaacgcgctacttacg
ggcagcagctcctacctctacgcaagtgtgctggagcactttttcgccgcgtactgctca
gttaactcgtttacgcgcgtgctagttaaattgaaaaaccgagaagattacctaaaaaaa
tgcccaccaagagcaggtcaaaaagtctttctgtaa

DBGET integrated database retrieval system