KEGG   Teredinibacter turnerae: TERTU_1656
Entry
TERTU_1656        CDS       T00952                                 

Definition
(GenBank) type VI secretion protein, EvpB/family
  KO
K11900  type VI secretion system protein ImpC
Organism
ttu  Teredinibacter turnerae
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ttu02044]
    TERTU_1656
Secretion system [BR:ttu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TERTU_1656
SSDB
Motif
Pfam: VipB VipB_2 DUF3386
Other DBs
NCBI-ProteinID: ACR14729
UniProt: C5BU04
Position
complement(1708917..1710413)
AA seq 498 aa
MANNEELMEGQASATEVATDLSFLEQAIDATKQTPRDETEELLKTLTREATKGTVKWDKN
LSVTINAAINAIDEAMSNQLRAIMHHEKFQTLEGSWRGLQYLVMNSETSSHLKLRVMNIS
KKELKRDLEKAVEFDQSQIFKKVYESEFGTAGGEPYAALVGDYDFSSHPDDISLLTKMSN
IAASGFCPFVSSAAPQMFGFESFTELSKPRDLEKIFESAEYIQWRSFRESEDSRFVTLTM
PRTLARLPYGAATKPVEEFNFEEGNVTADGKHLENEHDSYCWMNAAYTLGATLSKAFASY
GWCTSIRGAEGGGKVEGLPSHVFVSDDGDTDQKCPTEIGITDRREAELSKLGFLPLCHYK
NTDFAVFFGAQTTQKPKKFDDPDASANSAISARLPYIMATSRIAHFLKVMARDKIGSFME
ADEAERWLNKWLSQYVNGTPGASAEMKAKYPLAEARVEVKEVPGQPGVFNAVAYLRPWLQ
VEELTASLRLVANIPKAG
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggcgaataatgaagaattaatggaaggccaggcgagtgcaacagaagttgccacggac
ctgagcttcctcgaacaagcgattgacgcaaccaaacaaacgccacgcgatgaaaccgaa
gagctgttgaagacactcactcgtgaagcaacgaaaggcactgtaaagtgggacaaaaac
ctcagcgtaacaatcaacgctgcgattaacgcgatcgacgaggcaatgtctaatcagttg
cgggccatcatgcaccatgaaaagtttcaaacgctggaaggttcatggcgtggcttgcag
tacctggtgatgaattctgaaacaagctcgcaccttaaactgcgagtgatgaatatcagc
aaaaaagagctcaagcgcgacttggaaaaggcggtcgaattcgaccaaagccagatattc
aagaaagtgtacgaaagcgaattcggcactgcgggtggagaaccctacgccgctctcgtc
ggcgactacgacttttcatctcaccccgatgatatttctctgctcaccaaaatgtcgaat
atcgccgcatctggtttctgcccatttgtttcatcagcagcaccacaaatgtttggtttc
gaatcatttacagagctctctaaacctcgcgacctggaaaaaatattcgaatctgcggag
tacattcaatggcggagtttccgcgaaagtgaagactcccgctttgtaaccctgaccatg
ccccgcacgctcgcacgcctgccgtatggcgcagccacaaaaccggtagaagagttcaat
ttcgaagaaggtaacgttaccgccgacggtaagcatctcgagaatgagcacgattcctat
tgctggatgaacgcggcttatacgttaggtgcaacactgagcaaagctttcgccagttat
ggttggtgcaccagtattcgaggtgctgagggtggcggtaaggtagaaggtctacccagt
cacgttttcgtaagtgatgatggcgataccgatcagaaatgcccaaccgaaataggcatc
acagatcgccgtgaagcagaactgagtaaacttggttttctgccgctgtgtcattacaag
aacacagattttgcggtatttttcggcgcgcaaactacgcaaaagccgaagaaattcgac
gaccctgatgcctctgccaattctgccatatctgcgcgcctgccctacatcatggccact
tcccgtatcgcccactttctcaaagttatggcacgggacaaaattggctcctttatggaa
gccgatgaagccgagcgctggctaaacaaatggctgagtcaatatgtgaatggaacaccg
ggcgctagcgcagaaatgaaagcgaagtatcctttagcagaagcccgcgtggaagtgaaa
gaagtcccaggtcagccaggagtatttaacgcagtagcctatttgcgaccctggctccaa
gtggaggaactgaccgcgtcgctgaggctcgtcgccaatattcctaaagcgggttaa

DBGET integrated database retrieval system