KEGG   Teredinibacter turnerae: TERTU_1974Help
Entry
TERTU_1974        CDS       T00952                                 

Gene name
cysG
Definition
(GenBank) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00860  Porphyrin and chlorophyll metabolism
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
Module
ttu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TERTU_1974 (cysG)
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     TERTU_1974 (cysG)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     TERTU_1974 (cysG)
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     TERTU_1974 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M Radical_SAM Shikimate_DH TetR_C_12
Motif
Other DBs
NCBI-ProteinID: ACR14275
UniProt: C5BIK5
Position
2015288..2016667
Genome map
AA seq 459 aa AA seqDB search
MDYLPLFFDLKTKPCLVVGGGTIATRKARLLAKAGACISVVAPDAQDELAQLVKSSGGQL
HTQDYSSALIGQSVLVISATDIESVNRQVSEDCHARQIPVNVVDSPALCSVITPAIVDRS
PLIIAASSGGESPVLARRVRTQLESTFPASYGRLAKFASRFRDAVKSRFSDGEQRRRFWE
SVLGGTIAEQVLAGSESEAEIALQKRITAGDVADRGEVYLVGAGPGDPDLLTFKALRLMQ
QAEVVLYDRLVSEPILEMVRRDADRIYVGKRRSEHTMPQEQINQLLLRLAQEGKRVLRLK
GGDPFIFGRGGEEIDLLAAHQIPFQVVPGITAASGCSAYAGIPLTHRDYSSSVRFITGHL
KNGEVNFDWQEFVADHQTLVFYMGLVGLEQICTKMIEFGKPADTPVALVERGTLPTQVVH
TGTLASMPMKVKNTEIHAPTLLIIGGVVALHKSLGWFKR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggactacctcccacttttttttgatctcaaaaccaaaccgtgcctggtcgttggtggc
ggcaccatagcgactcgcaaagctcgccttctcgccaaagcgggtgcgtgtatttctgtg
gttgcgcctgatgcccaggacgagttggcacaattggtcaaatcatccggtgggcaactc
cacacacaagactatagctcagcgttaattggccaatcggtactggtcatttcggcgacg
gatatcgaatccgtcaatcgccaggtatctgaagattgtcatgccagacaaattcccgtg
aatgtggttgatagccccgcgttgtgcagcgtcatcaccccagcgattgtcgatcgcagc
ccgctgattatcgccgcgagcagtggcggtgaatccccagtgttggcccgacgggtgcga
acccaactggagtcgacctttcccgcgtcatacggcaggctggcaaaatttgccagtcgt
tttcgagatgcggttaaaagccgtttcagcgatggcgagcagcggcgacgcttctgggaa
agcgtactcggcggcactattgctgagcaggtgttggcgggcagcgaatctgaagcggaa
atcgcgttgcaaaaacgcattaccgcaggcgatgtagcggatcgtggagaggtgtatttg
gtaggggcagggcccggcgatcccgatcttttgaccttcaaagcgctacgcttaatgcag
caggcagaagttgtactgtacgatagactggtgtcggagccgattcttgaaatggtccgg
cgcgacgccgaccgtatttatgtgggtaagcgccgcagcgaacataccatgccgcaggag
cagattaaccagttgctcctgcggctcgcccaggaaggcaagcgggtgctccggcttaaa
ggtggtgatccctttatttttggccgcggaggtgaagaaattgatctgctggcagcgcat
cagattccgtttcaagtggtgcctggcatcacggcggcaagtgggtgctcagcttacgcg
ggaattccgttaacgcaccgcgattactccagttctgtgcggtttattactgggcatctt
aaaaacggtgaggtcaacttcgattggcaagagtttgtggcggaccaccagacgctcgtg
ttttacatggggctggtcggactggaacaaatttgcactaaaatgatcgaattcggtaag
cccgcagatacgccggtggcgttggtggagcggggaaccttacctacgcaggttgtgcat
acaggcaccttggcatcaatgccaatgaaggtaaaaaatacggagattcatgcaccgaca
ctgctgataatcggtggtgtagtggctttgcacaagtctctggggtggttcaagcgttaa

DBGET integrated database retrieval system