KEGG   Teredinibacter turnerae: TERTU_2598Help
Entry
TERTU_2598        CDS       T00952                                 

Gene name
rrmA
Definition
(GenBank) ribosomal RNA large subunit methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ttu  Teredinibacter turnerae
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ttu03009]
    TERTU_2598 (rrmA)
Enzymes [BR:ttu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     TERTU_2598 (rrmA)
Ribosome biogenesis [BR:ttu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    TERTU_2598 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_32 Ubie_methyltran MTS PrmA Methyltransf_9 MetW CMAS
Motif
Other DBs
NCBI-ProteinID: ACR11613
UniProt: C5BLS8
Position
complement(2875804..2876658)
Genome map
AA seq 284 aa AA seqDB search
MSWCCPKCMEPLIQQDKIFRCAQNHQYDQARQGYLNLLLANQKNSRNPGDSDTMIDARKA
FLRAGFYAPLVEALQQAVCANVNKSAGCQLLDLGCGEGYYLEKIVASLGGSATAYGVDIS
KPAVRRAAVAGRQLQAKCEGLALFYAVASTYAIPLEDNCIDIALNVFAPFDGQEVLRVLR
RGGLLVRVSPAERHLFQLKEKLYAEVRQHEKPAALNGFSIRTEQRLQFLIKLPNAAAIES
LLAMTPLAWNGDPEARVALVGYEELSVEADFYIQVLEPEEMCQQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgagttggtgttgtccgaagtgcatggaaccgttaattcagcaggataaaatctttcgg
tgcgcccaaaatcatcagtacgatcaagcgcggcaaggctatttaaatcttctgcttgcg
aaccagaaaaacagccgtaaccctggtgatagtgacaccatgattgatgcgcgcaaagcc
tttttgcgtgctggtttttatgcgccattagttgaagcattgcagcaagcagtgtgcgca
aatgtaaataaaagcgcaggttgtcagcttttggatttaggctgcggtgaaggctattat
ctcgaaaaaattgtcgcctcactcggtggttccgccactgcttacggcgtcgatatttcc
aagcctgctgtgcgcagagcagcagtagcgggcagacagttgcaagcaaaatgtgaaggg
ctagcgctgttttacgcggtcgccagtacgtatgccattcctctggaagacaattgcatt
gatattgcgctcaatgtttttgcgcctttcgatggacaagaagtattgcgggtgttgcgc
cgcggcggcttgttggtgagagtcagtcctgcagagcggcatttgtttcagctaaaggaa
aaactctacgcagaggtgcgccaacacgaaaagccggcggcactgaacggtttttcgata
cgcactgagcagcgtttacagtttttaatcaagttacctaacgcggcagcaattgaaagt
ttgttggcaatgacgccgcttgcctggaatggcgaccccgaggcgagggtagctctggtt
gggtatgaggagctcagtgttgaggcggatttttatattcaagtacttgagcccgaggaa
atgtgtcagcaatga

DBGET integrated database retrieval system