KEGG   Teredinibacter turnerae: TERTU_2931Help
Entry
TERTU_2931        CDS       T00952                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00010  Glycolysis / Gluconeogenesis
ttu00052  Galactose metabolism
ttu00500  Starch and sucrose metabolism
ttu00520  Amino sugar and nucleotide sugar metabolism
ttu00521  Streptomycin biosynthesis
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01130  Biosynthesis of antibiotics
ttu01200  Carbon metabolism
Module
ttu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ttu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERTU_2931 (glk)
   00052 Galactose metabolism
    TERTU_2931 (glk)
   00500 Starch and sucrose metabolism
    TERTU_2931 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    TERTU_2931 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TERTU_2931 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TERTU_2931 (glk)
Enzymes [BR:ttu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TERTU_2931 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACR13360
UniProt: C5BNE2
Position
complement(3285487..3286446)
Genome map
AA seq 319 aa AA seqDB search
MFPSIVADIGGTNARFALVTGTENGQFVIENIQILNGAEYEGFADALRAYMDSLGSLKPF
SACVAIAGPIAGDSVQMTNLSWSFTQSGIRKAFGFEKFAVINDFGALAVATSALNPTDLV
SVKGGSRNPEGNKAIMGPGTGLGVAGLAYTGSNWLPIPSEGGHVNIAPASALECEVIKAA
IATHGHVSAETFISGPGLVNLYRALCEVNGVSPRELQPKDITADAMSAADQTCVYTLNLF
CSFLGTVAGNLALTYGASGGVYLAGGILPRMLDFLKDSDFKSRFSNKGVMSHYVDDIPVD
IIAHPQTAFLGAATWLAQL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttcccttccattgttgccgacatcggcggcacaaatgctcgtttcgcgttggtaact
ggtacagaaaatggccagtttgttatcgaaaatattcagatcctcaatggtgctgaatac
gaaggctttgctgacgcactgcgggcatacatggattcgctcggttcactcaagcccttt
tctgcctgtgttgccatcgcgggccccattgctggggatagcgtacaaatgaccaacctg
agctggtcgtttacccaatctggcatccgcaaagcgttcggcttcgaaaaatttgccgtg
attaacgatttcggcgcgcttgcggtggcgaccagcgcacttaaccccaccgatctagtt
tctgttaaaggcggctcaaggaacccggaaggcaacaaggctattatgggcccaggcact
ggactcggtgtggcggggctggcgtataccggttctaactggctgccaatacccagcgag
ggggggcatgtgaatattgcacctgcatccgcgctggaatgcgaggttattaaagcggct
atcgccacccatggccacgtgtctgcagaaacgtttatttcgggcccagggctggtgaat
ttatatcgcgccctgtgcgaggttaacggtgtgtctcctcgcgagctgcaaccgaaagat
atcaccgccgatgcgatgtcagctgcggaccaaacctgcgtgtatacgcttaacctgttc
tgtagctttttgggtacggtggcgggtaatctggcattaacctatggcgctagcggtggc
gtttatctggcgggaggcattttgccgaggatgctggattttctgaaagacagcgatttt
aaatcgcgcttctccaataagggggtaatgtctcactacgtggatgatattcccgtggat
attatcgcccatccacaaaccgcatttttgggtgctgcaacctggctcgcacagctgtag

DBGET integrated database retrieval system