KEGG   Teredinibacter turnerae: TERTU_2959Help
Entry
TERTU_2959        CDS       T00952                                 

Gene name
argS
Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TERTU_2959 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ttu01007]
    TERTU_2959 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ttu03016]
    TERTU_2959 (argS)
   03029 Mitochondrial biogenesis [BR:ttu03029]
    TERTU_2959 (argS)
Enzymes [BR:ttu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     TERTU_2959 (argS)
Amino acid related enzymes [BR:ttu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   TERTU_2959 (argS)
Transfer RNA biogenesis [BR:ttu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TERTU_2959 (argS)
 Prokaryotic Type
   Other AARSs
    TERTU_2959 (argS)
Mitochondrial biogenesis [BR:ttu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    TERTU_2959 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1g tRNA-synt_1 CAF1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ACR14530
UniProt: C5BNG6
Position
3318018..3319754
Genome map
AA seq 578 aa AA seqDB search
MNIRKFLADRVRSAMSDVGIPNDYSPHLAISKKPGFGDYQANGAMAAAKAMKTNPRELAQ
SIVDSLDLSGVAEKVEIAGPGFINIHLENAWLARQLAESSSTANLAAQTEQEAQTVVVDY
SSPNLAKEMHVGHLRSTIIGDCLARILEFNGDKVIRQNHVGDWGTQFGMLIAELETQLSD
GDKPDFALKDLESFYQKAKAHFDTDAAFATKARDYVVRLQSGDQHILNLWESFKRVSLKH
SEEIYSLLNVTLGPQDVRGESAYNDDLAAVVSELKAQGLAVEDDGAQVVFLQELADKNGD
PSPVIVQKKDGGYLYSTTDLAALRYRTGELAADRILYFIDARQSLHMQQVFTVARKANFV
NEWVSLEHHPFGTMMGADGKPFKTRSGGTVKLAELLEEAVERASQVVAANSELDAQEAAD
IARKVGIGAIKYADLSKTRTNDYVFNWDAMLSFEGNTGPYLQYAYTRIKSIFRKADLDLE
SFAADLNIYEAQEKALALKTLQFAEVVEQVASEALPHVLCNYLYDLSSLFMTFYEACPIL
KSDVPEDTRNSRLVLSASVAKTLALGLDLLGIEVMERM
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcgcaagttccttgctgatcgcgtccgtagtgccatgtcagacgtcggcata
cccaacgactacagccctcacctggccatcagcaaaaagccgggcttcggcgactatcag
gcaaatggggccatggctgccgcgaaagcgatgaaaaccaatccacgagaactggcgcaa
tcgattgtcgatagcctggatctttccggtgtcgccgaaaaggtcgaaatcgctggcccg
ggatttatcaatatccatctcgaaaacgcctggttagcgcgccaactggcggagtcatcc
agtaccgctaacctcgcggcgcaaaccgagcaagaagcacagactgtcgtggtcgactac
tcctcacccaacctcgccaaagagatgcatgtaggccatctgcgttccaccatcattggt
gattgtctggcgcgtatcttggagtttaatggcgataaggttattcgccagaatcacgtc
ggcgattggggaacccagttcgggatgctgattgccgagctggaaacgcaactcagcgat
ggcgacaaaccagatttcgcacttaaagacctggaaagcttctaccaaaaagccaaagca
cacttcgataccgacgcagcctttgccaccaaagcgcgcgactatgtggtacgcctgcaa
tctggcgatcagcatattttgaatttgtgggaatcctttaaacgggtttcactcaagcac
agcgaagaaatatacagcctgctgaatgtcactctgggcccacaagatgtgcgtggtgaa
agtgcctataacgacgaccttgcagcggtcgtcagtgaattgaaagcccagggcctggca
gtggaagatgacggcgcacaagtggtgtttttgcaggaactggccgacaaaaacggcgac
cctagcccggttatcgtgcagaaaaaagacggcgggtatttgtattccaccaccgacctc
gcagcgttgcgctaccgcacaggcgagctggcggccgaccgtattctgtattttattgat
gcgcgacagtccctgcacatgcagcaggtgtttaccgtggctcgcaaggcgaatttcgtc
aacgaatgggtcagcctggagcatcatccgtttggcaccatgatgggggcagatggcaaa
ccatttaaaacccgcagcggcggtacagttaagctggcagaattgttggaagaagcggtc
gaacgcgccagccaggtggtcgccgccaatagcgagctggacgcacaggaagcggcggat
attgcacgtaaggtgggcattggcgcgataaaatatgccgatttatctaaaacacgtacc
aatgactatgtattcaattgggacgcgatgctcagcttcgaaggcaataccgggccttac
ctgcagtacgcctatacccgaatcaagagtattttccgcaaggccgacctggatctggag
agttttgcggcggacttgaatatttacgaagcccaggaaaaagcgctggcacttaaaaca
ctgcaattcgcagaggtcgtggagcaggttgccagcgaagcgctgccacatgttttgtgt
aactacttatacgatttgtccagcctgtttatgaccttctacgaagcctgcccgatactc
aaatcagacgtgccggaagatacccgtaacagtcgcttggtgttaagtgcctccgttgcc
aaaacacttgctctcgggctggaccttcttggcattgaggttatggaacggatgtag

DBGET integrated database retrieval system