KEGG   Teredinibacter turnerae: TERTU_3669Help
Entry
TERTU_3669        CDS       T00952                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00071  Fatty acid degradation
ttu00072  Synthesis and degradation of ketone bodies
ttu00280  Valine, leucine and isoleucine degradation
ttu00310  Lysine degradation
ttu00362  Benzoate degradation
ttu00380  Tryptophan metabolism
ttu00620  Pyruvate metabolism
ttu00630  Glyoxylate and dicarboxylate metabolism
ttu00640  Propanoate metabolism
ttu00650  Butanoate metabolism
ttu00900  Terpenoid backbone biosynthesis
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01130  Biosynthesis of antibiotics
ttu01200  Carbon metabolism
ttu01212  Fatty acid metabolism
ttu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TERTU_3669
   00630 Glyoxylate and dicarboxylate metabolism
    TERTU_3669
   00640 Propanoate metabolism
    TERTU_3669
   00650 Butanoate metabolism
    TERTU_3669
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TERTU_3669
   00072 Synthesis and degradation of ketone bodies
    TERTU_3669
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TERTU_3669
   00310 Lysine degradation
    TERTU_3669
   00380 Tryptophan metabolism
    TERTU_3669
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TERTU_3669
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TERTU_3669
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TERTU_3669
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ttu04147]
    TERTU_3669
Enzymes [BR:ttu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TERTU_3669
Exosome [BR:ttu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TERTU_3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACR14474
UniProt: C5BS55
Position
complement(4057945..4059123)
Genome map
AA seq 392 aa AA seqDB search
MSDPIVVVGMARTAMGGMQGVFNDVPAHALGGYAIAGALADAKVSPDDVKEVIMGCVLPA
GLGQAPARQAALAAGVPQSTPTSTVNKVCGSGMKSVMFACSELMAGDAGIVVAGGMENMS
RAPYMLDKARGGYRLGHSQIYDHMFLDGLQDAYSGELMGVFAEATAEKYGFTREAQDAFA
IESLRRAQAAITEGRFQREIVPVTLKTRKGETVVATDEQPGAARPDKIPQLKPAFKPNGT
VTAANASSISDGAAALVLMRESTAIAHKLDPIARIHGYRQHAQAPEWFTTAPVGAIKGLL
EVNNWSAQDVDLYEVNEAFAVVTMAAMKELDLDPSKVNVNGGACALGHPLGASGARVLVT
LIAALQNQNKQRGIAALCIGGGEGVAMGVEVV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatccgatagttgtggtaggtatggccagaacagcaatggggggaatgcagggt
gtgtttaatgatgttcctgctcacgcattaggcggttacgccatcgcaggagctttggct
gatgctaaagtttccccagacgacgtgaaagaagtgattatgggctgcgtgctaccggcg
ggactaggccaggcaccagcgcggcaggctgcactcgcggccggtgtacctcaatctacc
cccacaagtacggttaacaaagtgtgcggttcggggatgaaatcggtgatgttcgcgtgc
agcgagctgatggcgggcgatgcaggaattgtggtggcgggcggtatggagaatatgagt
cgcgcgccctatatgctcgacaaagccaggggcggctatcgccttggacacagtcaaatc
tacgaccatatgtttctcgacggactgcaagacgcctacagcggcgaattaatgggcgtg
ttcgcggaagctaccgcagagaagtacggatttacgcgcgaagcacaggatgcatttgcg
atagagtctctgcgccgcgcgcaggccgcaattacagaaggccgctttcaacgggaaatc
gtccctgtgaccttaaaaacccgcaaaggtgaaactgttgttgctaccgatgaacagcct
ggcgcagcgcgtcccgacaaaattcctcaacttaagcccgcattcaagcccaatggtacc
gttactgcggcaaatgcgagctctatctccgatggtgccgcagcgctggtgttgatgcgc
gagtccactgcgatcgcccacaagctcgaccccatcgcgcgtattcacggttatcgccag
catgcgcaggcgcctgagtggtttaccaccgccccggtgggtgccataaaagggctgctt
gaggtgaataactggtctgcgcaggatgtcgatctatatgaagtgaatgaagcatttgct
gtggtcaccatggctgcgatgaaagaactggatcttgaccccagcaaagtgaatgtaaac
ggtggtgcctgtgccctcggtcacccgcttggggcatcaggcgcgagagttctcgtcacc
ttaattgcagccctgcaaaaccagaacaaacagcgcggcatagcggcactgtgtattggt
ggtggggaaggggttgcgatgggggttgaggtggtttag

DBGET integrated database retrieval system