KEGG   Teredinibacter turnerae: TERTU_3696
Entry
TERTU_3696        CDS       T00952                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00740  Riboflavin metabolism
ttu00790  Folate biosynthesis
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    TERTU_3696 (ribA)
   00790 Folate biosynthesis
    TERTU_3696 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    TERTU_3696 (ribA)
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     TERTU_3696 (ribA)
SSDB
Motif
Pfam: GTP_cyclohydro2
Other DBs
NCBI-ProteinID: ACR11736
UniProt: C5BS80
Position
complement(4086684..4087283)
AA seq 199 aa
MAIEYVESSKLPTAWGMFEMHGFTDSETDKEHLVLSMGDLAGDEPVLVRIHSECLTGDAL
FSLRCDCGAQLQAAMHRISIEGRGAIFYLRQEGRGIGLVNKIRAYHLQDKGADTVEANEA
LGFGADMRDYSMLKPMFEKMGISRVKLMTNNPRKIDALIGLGIDIAERLPHETGRNPHNS
HYLETKRGKLGHLLEGDSE
NT seq 600 nt   +upstreamnt  +downstreamnt
gtggcaatagagtatgtagagtcttcgaaacttcccacggcgtggggtatgttcgaaatg
cacgggttcaccgacagcgaaacggataaagagcatttggtattatcgatgggcgatttg
gctggggatgagccagtgttggtgcgcatccactctgaatgtctcaccggtgacgcgctc
ttttctttgcgttgtgattgtggggctcaactgcaagcagcgatgcatcggatatccatt
gaaggccgcggcgctattttttatttgcgccaggaagggcgtgggatcggcttagttaat
aagatccgggcctaccacctacaggataaaggtgccgatactgtagaggcgaatgaggcc
cttggtttcggcgcggacatgcgcgactattcaatgcttaagccgatgttcgaaaagatg
gggattagtcgggttaaactcatgaccaataatccgcgtaaaatcgatgctctcataggg
ttgggaattgatattgccgagcggctcccccatgaaacaggtcgtaatccccacaacagt
cactacctggagacaaagcgcggcaagttaggacatctgctcgaaggggattccgaatag

DBGET integrated database retrieval system