KEGG   Teredinibacter turnerae: TERTU_3845Help
Entry
TERTU_3845        CDS       T00952                                 

Gene name
hemA
Definition
(GenBank) glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00860  Porphyrin and chlorophyll metabolism
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
Module
ttu_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
ttu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TERTU_3845 (hemA)
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     TERTU_3845 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_DH GlutR_N GlutR_dimer F420_oxidored 2-Hacid_dh_C DeoRC DUF3813
Motif
Other DBs
NCBI-ProteinID: ACR14420
UniProt: C5BSZ7
Position
complement(4243851..4245098)
Genome map
AA seq 415 aa AA seqDB search
MTLLALGINHNTATLDVREKVAFSPAELEVALCALRESGLAEEVAILSTCNRTEIYCETG
AEAQHLLVWLAEHKAASAQELQHAHYARWGDDAARHMMAVASGLDSLVLGEPQILGQMKS
CYAVAREAGVLGRGLHDAFQRVFAVAKRVRSETAIGENPVSVAYAAVSLAQQIFSDLKQD
TALLIGAGETIELVARHLKNQGIKKLIVANRTLENAHALAKEFAAEAILLADIPEYLPTA
DIVISSTASQLPLLGKGAVEVALKKRKHKPMFMVDIAVPRDIEPQVGDLADVYLFTVDDL
KEVIDENKKSREEAAKTARTIIDEGVERYQLDQRALSAVELVKDFRQQTEAVRDQEVQKA
LNALRSGADPEELLLTLSRNLTNKFMHQPTTALKRASSEGREQLLQDFKSLFGLD
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacgttacttgccctcggcattaatcacaataccgcaacgctggatgttcgcgaaaag
gtggctttttcacctgccgagctggaagtggcgttgtgcgcgctgcgggagtcgggtttg
gcagaggaggtcgccatactgtccacctgcaatcgcaccgaaatctactgcgaaaccggc
gcggaggcgcagcatttgctggtttggctggcagagcataaggccgcgagtgcgcaagaa
ttgcaacacgcacactacgcccgttggggcgacgatgcagcgcgccatatgatggcggtg
gccagtggactggattcgctggtgctgggggagccgcagattcttgggcaaatgaaatcc
tgctatgcggttgcccgcgaagccggagtgctggggcgcggcctgcacgatgcctttcag
cgggtattcgcggtggccaagcgggtgcgctctgaaaccgccattggcgaaaacccggtg
tcggtcgcctatgcggcggtgtcacttgctcagcaaattttttctgacttaaaacaggac
accgcactcttgattggtgcgggtgaaaccattgaactggttgcccgacacttgaaaaat
cagggcataaaaaagctgattgtcgccaaccgaaccctggaaaatgcgcacgcgcttgca
aaagagtttgccgcagaggcgattttgttggcggacattcccgaatatctgccaaccgct
gacatcgtgatatcatccaccgccagccagctcccgctgctcggtaaaggtgcagtggaa
gtcgctttaaaaaaacgtaagcacaagccgatgtttatggtggatattgccgtgccgagg
gatattgaaccccaggtgggcgatttggctgacgtgtacctgtttaccgtcgacgacttg
aaagaggtgatcgacgaaaacaaaaaatcccgtgaagaagccgcaaaaactgcgcgcact
attattgatgaaggcgtagagcgttaccaattggaccagcgcgcattgtcggcggtcgag
ctggtaaaggattttcgccagcagacggaagcggtgcgggatcaggaagtacaaaaagca
ctgaacgcgttgcgcagcggggcggacccggaagaattgctcctaaccctgagtcgcaat
ctcaccaataaatttatgcatcagcccaccaccgcgcttaaacgcgccagctcagagggg
cgggaacaactgctgcaagattttaaatcgttgttcgggctcgattaa

DBGET integrated database retrieval system