KEGG   Teredinibacter turnerae: TERTU_4427
Entry
TERTU_4427        CDS       T00952                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00010  Glycolysis / Gluconeogenesis
ttu00260  Glycine, serine and threonine metabolism
ttu00680  Methane metabolism
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01200  Carbon metabolism
ttu01230  Biosynthesis of amino acids
Module
ttu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ttu_M00002  Glycolysis, core module involving three-carbon compounds
ttu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERTU_4427 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    TERTU_4427 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TERTU_4427 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ttu04131]
    TERTU_4427 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ttu04147]
    TERTU_4427 (gpmA)
Enzymes [BR:ttu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TERTU_4427 (gpmA)
Membrane trafficking [BR:ttu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TERTU_4427 (gpmA)
Exosome [BR:ttu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TERTU_4427 (gpmA)
  Exosomal proteins of melanoma cells
   TERTU_4427 (gpmA)
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: ACR14463
UniProt: C5BJ25
Position
complement(4901456..4902202)
AA seq 248 aa
MYKLVLIRHGESQWNLENRFTGWHDVDLTDTGREQARNGGRMLKEAGFEFDLAYSSVLTR
AIRTLNLVLEEMGQMWLPVERHWRLNERHYGALTGLDKAETAAKHGDEQVKIWRRSFDVP
PPDVDESSEHFPAHDPRYRGIDKNVLPKAESLKLTIDRVLPYWHDVIRPSILGGKRVIIA
AHGNSLRALVKYLDDMSDAEILDLNIPTGVPLVYDLDADLRPIKREYLGDPEAIKAMMDA
VAKQGQAK
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtacaaattggtcttaattcgccacggtgagagccagtggaacctggaaaaccgtttt
actggctggcacgacgtggacctgacagacaccggtcgcgaacaagcgcgcaacggtggc
cgtatgctcaaggaagccggtttcgaattcgacctggcctactcctccgtgctgactcgc
gcgattcgtactctgaacctggtgctggaagaaatgggtcagatgtggctgcctgttgag
cgtcactggcgcttgaacgagcgtcactacggtgcacttaccggcttggacaaagcggaa
actgcagccaaacacggcgacgagcaagttaaaatctggcgccgtagctttgacgttcca
ccacccgatgttgacgagagcagcgaacacttccccgcgcacgacccacgctaccgcggt
atcgacaaaaacgtactgccgaaagcggaaagcctgaagctgaccatcgaccgcgtgctg
ccttactggcacgatgtgattcgcccatccattctcggtggcaagcgcgttattatcgcg
gctcacggcaatagtctgcgtgcgctggttaaatatctggatgatatgtctgacgcagag
atccttgatttgaacatcccaacgggtgtgccgctggtttatgacctggacgcagacctg
cgcccaatcaagcgtgaatacctgggcgatccagaagcgattaaagcgatgatggacgct
gtggccaagcaggggcaggcgaagtaa

DBGET integrated database retrieval system