KEGG   Teredinibacter turnerae: TERTU_4521Help
Entry
TERTU_4521        CDS       T00952                                 

Definition
(GenBank) putative undecaprenyl-phosphate galactosephosphotransferase
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
ttu  Teredinibacter turnerae
Brite
KEGG Orthology (KO) [BR:ttu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:ttu01005]
    TERTU_4521
Enzymes [BR:ttu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     TERTU_4521
Lipopolysaccharide biosynthesis proteins [BR:ttu01005]
 O-antigen
  TERTU_4521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf
Motif
Other DBs
NCBI-ProteinID: ACR11517
UniProt: C5BJN6
Position
complement(4970397..4972070)
Genome map
AA seq 557 aa AA seqDB search
MDRGIDLSALPRRRENPARPEAQDFGDLPVMDYWLDQRSVRRAFDGVDRRQAFMQRKNIL
AFPTRNQAGTARRLQLRLRRAHLIHQLFLLLGDAFALALSLLFVTAIYVIWTGQGSQFVR
SLLPSLWEFGFVSTVYLMYNWLQGNYAKKQSIADTLRAVSKAVFVAISVQSVLAGLVGNR
ALLLGLLITWCLALVLVPIFRIGIKRIMYNCGIWAQPTVILGAGENARRTADAIQSDWLL
GSHIVEFINFSEDRSAPEKQPLTHINVNGHSIPVRNINGLTSGLFEALGNPHIVVATDSA
DFWDIIRLLYEANVSYSSITIAPRMDGVPMIGLAMTHVFRHDVLMLTVQNNLARFIPRLI
KRSFDLVLSLSLIIALAPVLAVIALAVRASGKHVFYGHQRVGRDGRLFGCYKFRSMFNNS
DQLLRDHLRDNPEARAEWNRDYKLKQDPRVTRVGNFLRKTSLDELPQLWNVVKGDMSLVG
PRPVVREELLRYHDKQGFYSRVRPGITGLWQVSGRNDVTYDERVNLDTWYSKNWSLWYDV
VILVKTLGVVVKRSGAY
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggaccgaggaatagatttgtcagcgctgccgcgtcggagagaaaatcctgcgcgccca
gaggcccaggattttggtgatttaccagtgatggactattggttggaccagcgcagtgtc
aggcgggcatttgatggtgttgatcggcgccaggcgtttatgcaacgcaagaacattctc
gcatttcccacgcgcaatcaggcgggaaccgcgcgtcgtttgcagttgcgcttacgccgc
gctcatctgattcatcagttgtttttgttgttgggcgatgcatttgcgctcgcactttcg
ctgctttttgttaccgctatttatgttatctggaccggccaggggtcgcagtttgtacgc
agcttgctgccgtcgctttgggagtttggtttcgtcagcacagtctacttaatgtacaac
tggctgcagggtaactatgccaaaaagcaatcgatcgccgacaccctgcgcgcggtatcc
aaagctgtgtttgtcgcgatttctgtgcagtcggtattggcgggtctggtgggcaaccgt
gcactgctgttgggtctactcattacatggtgcctcgcgctggttttggtacctattttt
cgtatcggcattaaacggattatgtataactgtggtatctgggctcagcctacggttatc
ttaggggcgggtgagaatgcccgccgcacggcggatgctattcaaagcgattggctgcta
ggttcgcatatcgttgaatttatcaatttttccgaagaccgctctgcgccggaaaaacag
ccactcacacatattaacgtgaacggccactctattccggtgcgaaatataaacgggtta
acgtctggattgttcgaagcactgggtaatccacacattgtggtagcgacggattccgcc
gacttttgggacatcattcgactgctatacgaagcgaacgtgtcttactccagtattacc
atcgcgccgcgtatggatggtgtgccgatgattgggctggcgatgactcatgtttttcgc
cacgatgtgttaatgctcacggtgcagaacaacctagcacgctttattccccgcctgatt
aaacgcagtttcgatttggtgctgtcactttcgttgatcatcgcactcgcgcctgtgttg
gcggtaatagcgctggcggtgcgcgccagtggcaagcatgttttctacggccaccagcgt
gtggggcgcgatgggcgtttgtttggctgctacaaatttcgcagtatgtttaacaatagt
gaccaattgttgcgggatcatttacgggataatccggaagctcgcgctgagtggaatcgc
gattacaagcttaagcaggacccgcgcgtgacgcgcgtagggaatttcctgcgcaaaacc
agtctggatgaactgccacagttgtggaacgtggttaaaggcgatatgagcttggtaggg
cctcggcctgtcgttcgtgaagagcttttacgttatcacgataagcaaggattctattcc
cgagtccggccaggtattactggtctttggcaggttagcggacgcaacgatgtcacttat
gatgaacgggtcaacctggacacctggtattccaaaaactggagcttgtggtacgacgtg
gtgatcctagtgaaaacgctcggcgtggttgtaaaaagatccggcgcttattag

DBGET integrated database retrieval system