KEGG   Tumebacillus avium: CBW65_08345Help
Entry
CBW65_08345       CDS       T04874                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tum  Tumebacillus avium
Pathway
tum03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tum00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CBW65_08345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tum03011]
    CBW65_08345
Ribosome [BR:tum03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CBW65_08345
  Bacteria
    CBW65_08345
  Archaea
    CBW65_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ARU61070
UniProt: A0A1Y0ILA4
Position
1790102..1790437
Genome map
AA seq 111 aa AA seqDB search
MQTAKAVARTVRIAPRKVRLVVDLIRGKKASEAIAILKHTPKAASPVVEKVLNSALANAD
HNYSLDLDSLYVKEVFVDQGPTLKRFRPRAQGRAFRIHKRTSHITVVLGEK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactgcgaaggcagtcgctcgtaccgtgcgtatcgcaccgcgcaaagtccgcctg
gttgtggacttgatccgcggcaagaaagcttcggaagcgatcgcgatcctcaagcacact
ccgaaagctgcatctccggttgttgaaaaggttctgaactccgctctggcgaatgcagac
cacaactacagcctggacctggacagcctctatgttaaagaagtattcgtggatcaagga
ccgaccctgaagcgcttccgtccgcgcgcacaaggccgtgcattccgtattcacaagcgc
accagccacatcaccgtggtactcggtgaaaagtag

DBGET integrated database retrieval system