KEGG   Tumebacillus avium: CBW65_11150Help
Entry
CBW65_11150       CDS       T04874                                 

Definition
(GenBank) hypothetical protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
tum  Tumebacillus avium
Pathway
tum00860  Porphyrin and chlorophyll metabolism
tum01100  Metabolic pathways
Module
tum_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:tum00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CBW65_11150
Enzymes [BR:tum01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CBW65_11150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ARU61501
UniProt: A0A1Y0ILU9
Position
2325052..2325609
Genome map
AA seq 185 aa AA seqDB search
MTTTLLLIRHGETDANVQRRYIGRTNVPLNQNGHAQAAKLRTALADHTITTIYHSPYQRT
HATALHLGDNLHADLRLAELDFGDWEHLTYDEIPDRDHLDKWYDDPWRLAPPNGETLHQL
DHRLTLWLYDIIRLHPNQTIAAVSHGGPLRWLLAKYLHRDTAQFHTLRLPPGGHAILKLT
EGDLR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacccttttgctgatccgccacggcgagacggacgccaacgtgcaacgccgc
tacatcggccgcaccaacgtcccgctcaaccaaaacggtcacgcccaagccgccaagctc
cgcaccgcccttgccgatcacaccatcactaccatctaccacagcccataccagcgcact
catgccaccgccctccatctcggcgacaacctgcacgccgacctgcgccttgccgagctg
gattttggcgactgggaacatctcacgtacgacgagatccccgaccgcgaccacctcgac
aagtggtacgacgacccgtggcgcctcgccccgccaaacggcgagaccctgcaccaactc
gaccaccgcctcaccctctggctgtacgacatcatacgcctgcaccccaaccaaaccatc
gccgccgtctcccacggaggaccgctgcgctggctgctggccaaatacctgcaccgcgat
accgcccagttccacaccttgcgcctcccgccgggcggccatgccatcctgaagctcacg
gaaggagacctgcgatga

DBGET integrated database retrieval system