KEGG   Tumebacillus avium: CBW65_22695Help
Entry
CBW65_22695       CDS       T04874                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tum  Tumebacillus avium
Pathway
tum00071  Fatty acid degradation
tum00072  Synthesis and degradation of ketone bodies
tum00280  Valine, leucine and isoleucine degradation
tum00310  Lysine degradation
tum00362  Benzoate degradation
tum00380  Tryptophan metabolism
tum00620  Pyruvate metabolism
tum00630  Glyoxylate and dicarboxylate metabolism
tum00640  Propanoate metabolism
tum00650  Butanoate metabolism
tum00900  Terpenoid backbone biosynthesis
tum01100  Metabolic pathways
tum01110  Biosynthesis of secondary metabolites
tum01120  Microbial metabolism in diverse environments
tum01130  Biosynthesis of antibiotics
tum01200  Carbon metabolism
tum01212  Fatty acid metabolism
tum02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBW65_22695
   00630 Glyoxylate and dicarboxylate metabolism
    CBW65_22695
   00640 Propanoate metabolism
    CBW65_22695
   00650 Butanoate metabolism
    CBW65_22695
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBW65_22695
   00072 Synthesis and degradation of ketone bodies
    CBW65_22695
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBW65_22695
   00310 Lysine degradation
    CBW65_22695
   00380 Tryptophan metabolism
    CBW65_22695
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBW65_22695
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBW65_22695
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBW65_22695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tum04147]
    CBW65_22695
Enzymes [BR:tum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBW65_22695
Exosome [BR:tum04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBW65_22695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HutP Homeobox_KN
Motif
Other DBs
NCBI-ProteinID: ARU63496
UniProt: A0A1Y0IUM8
Position
complement(4879729..4880910)
Genome map
AA seq 393 aa AA seqDB search
MKTVYLVSAVRSAITSFGGSFKDMMPSDLAAQLLTAAVERAGIDKAQVEEVILGHCIQRT
DEPNTARTAALKAGFPNTVPGYTIQRQCGSGMQAILSGMQQIQTGYADIVLAGGVEVMSS
SPYVLKQNRWGQRLQHSTVYDTVWECLTDPLTGDMMGHTAENLAEKYNITRDEQDTLALE
SHQKALAALESGRFEKEISPVTVQLGRGKTAEVTRDEHPRADISAEKLAKLRPSFNTDGG
SVTAGNASGLNDGACAVILMSEEKVQELGVTPLAKIIAGAVAGVEPELMGYGPVPAVNKL
LKQTGFTKDDIDLWEINEAFAAQYIAVEKLLDLDRSIVNVNGSGISLGHPVGATGARIVT
TLAHELHHKGLTRGIATLCIGGGMGLALMIERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactgtctacctcgtctccgccgtccgctccgccatcacttcgtttggcggttcc
tttaaagacatgatgccgtccgatctggctgcgcaactgctgaccgcagcggtcgagcgc
gcgggcatcgacaaagcgcaggtcgaagaagtcatcctcggccactgcatccagcgcacc
gacgagccgaacaccgcccgcaccgccgcgctgaaagccgggttcccgaacaccgtaccg
ggctacaccatccagcgccagtgcggctccggcatgcaggcgatcctgtccggcatgcag
cagatccagaccggctatgcggacatcgtgctcgccggcggcgtcgaagtcatgtcctcc
tcgccgtacgtgctcaaacaaaaccgctggggccagcgcctgcagcacagcaccgtctat
gacaccgtctgggaatgcctgaccgacccgctgaccggcgacatgatgggccacacggcg
gagaacctcgccgaaaaatacaacatcacccgcgacgagcaagataccctcgcgctcgaa
tcgcaccaaaaagcgctggccgctctggaatccggccgctttgaaaaagagatctcgccc
gtaaccgtgcagctcggccgcggcaaaacggcagaagtcacccgcgacgagcacccgcgc
gccgacatctccgccgagaagctcgccaagctgcgtccgtccttcaacaccgacggaggt
tcggtcaccgcaggcaacgcatccggcctcaacgacggcgcgtgtgccgtcatcctgatg
tctgaagaaaaagtccaagagctaggcgtcacaccgctcgccaaaatcatcgccggcgct
gtcgcaggcgtcgaacccgaactgatgggctacggcccggtcccggctgtgaacaaactg
ctgaagcagaccggcttcaccaaggacgacatcgacctctgggaaatcaatgaggcgttt
gccgcccaatacatcgccgtcgaaaagctgctcgaccttgaccgcagcatcgtcaacgtc
aacggctccggcatctcgctgggccatcccgtcggcgcaaccggcgcgcgcatcgtcacc
accctcgcacacgaactgcatcataaggggctgacccgaggcatcgccacgctctgcatc
ggcggcggcatgggccttgcgctgatgatcgagcgcgtctaa

DBGET integrated database retrieval system