KEGG   Tumebacillus avium: CBW65_23100Help
Entry
CBW65_23100       CDS       T04874                                 

Definition
(GenBank) aspartate--tRNA ligase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
tum  Tumebacillus avium
Pathway
tum00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tum00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CBW65_23100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tum01007]
    CBW65_23100
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tum03016]
    CBW65_23100
   03029 Mitochondrial biogenesis [BR:tum03029]
    CBW65_23100
Enzymes [BR:tum01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     CBW65_23100
Amino acid related enzymes [BR:tum01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   CBW65_23100
Transfer RNA biogenesis [BR:tum03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CBW65_23100
 Prokaryotic Type
   Other AARSs
    CBW65_23100
Mitochondrial biogenesis [BR:tum03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CBW65_23100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ARU63574
UniProt: A0A1Y0IW49
Position
complement(4992298..4994133)
Genome map
AA seq 611 aa AA seqDB search
MSEQQTLYRTHRAGELRKEHAGQTVVLTGWVQRRRDLGNLIFIDLRDRSGFAQVVFQPTE
EAGSQALMAQGDKLRGEYVIAIEGVVAEREAGAVNAKIPTGEIEVKVSKVEILNAAKNTP
FYIQDGIDVDENLRLKYRYLDLRRAEMQKIFLLRSKVTTYLRNFMDHNSFIEVETPILTK
STPEGARDYLVPSRVHPGEFYALPQSPQLFKQLLMVSGFERYYQIARCFRDEDLRADRQP
EFTQLDIEQSFMSMDQFQEMVEEMMTGVFQATMNVEIPRPFPRITYREAMARYGSDKPDV
RFGLELQDLTEQVRGSGFKVFNMAIENGGEVKCIVAPGCASYSRKQIDELEAFVKRYGAK
GMAWIAVQEEGVKSPIAKFFSEEEMAAIIAQAGAQKGDLLLFAADSKKVVADSLGALRSK
LGKELGLIDESSFKFIWVTEFPLLEHDEEANRYVAAHHPFTMPMEEDLHLLETDPANVRA
KAYDLALNGFEIGGGSMRIFRREIQERMFQALGFSREEAWEQFGFLLEAFEYGTPPHGGI
AFGLDRLIMIMAGRQSLRDTIAFPKTSSASDLMTQAPSPVVTEQLDTLHIALGGKALSGV
EKQEAEETEAK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacagcaaacattgtatcgcacgcaccgcgcgggcgaacttcgcaaagaacac
gccggccaaacggtcgtcctgaccggctgggtacagcgccgccgcgacctcggcaacctg
atcttcatcgacctgcgcgaccgttccggctttgcccaagtcgtgttccagccgaccgaa
gaagcgggcagccaagcgctgatggcgcaaggcgacaagctccgcggtgaatacgtgatc
gcgatcgaaggcgttgtggccgagcgtgaagcgggcgcggtcaacgccaagatcccgacc
ggcgagatcgaagtcaaagtctcgaaagtcgaaatcttgaacgctgcgaaaaacacgccg
ttctacatccaagacggcattgatgtcgatgagaatctgcgcctgaaataccgctacctc
gacctgcgccgcgcggagatgcaaaagatcttcctgctccgctcgaaagtgaccacctat
ctgcgcaacttcatggaccacaactccttcatcgaagtggaaacgccgatcctgaccaaa
tcgaccccggaaggcgcacgcgactacctcgtgccgtcccgcgtccatccgggcgagttc
tacgccctgccgcagtcgccgcagctgttcaagcagctcctgatggtctccggctttgag
cgctactaccagatcgcgcgctgcttccgcgatgaagacttgcgcgcagaccgccagccg
gaattcacccagctcgacatcgagcagtccttcatgtcgatggatcagttccaagagatg
gtcgaagagatgatgacaggcgtgttccaagcgacgatgaacgtcgagattccgcgtccg
ttcccgcgcatcacctatcgcgaagcgatggcgcgctacggctccgataagccggacgtc
cgctttggcctcgaactgcaagacctgaccgagcaagtgcgcggctccggcttcaaagtg
ttcaacatggcgatcgaaaatggcggcgaagtgaaatgcatcgtggcgccgggctgcgcg
tcctactcccgcaagcagatcgacgagctggaagcgttcgtcaagcgctacggggcaaaa
ggcatggcctggatcgctgttcaagaagaaggcgtgaagtcgccgatcgccaagttcttc
tccgaagaagagatggcagcgatcatcgcccaggcgggcgcgcaaaaaggcgacctgctg
ctcttcgcggccgacagcaagaaagtggtcgccgattcccttggcgctctgcgctcgaag
ctcggcaaagagcttggcctgatcgacgaaagcagcttcaagttcatctgggtcaccgag
ttcccgctgcttgagcatgacgaagaagcgaaccgctacgtcgccgctcaccatccgttc
accatgccgatggaagaagacctgcacctgttggaaaccgacccggcaaacgtccgcgcc
aaagcgtacgaccttgccttgaacggctttgagatcggcggcggctcgatgcggatcttc
cgccgcgagattcaggagcgcatgttccaagccttgggcttctcgagggaagaagcgtgg
gagcagtttggcttcctgctcgaagcgtttgagtacggcactccgccgcacggcggcatc
gcgtttggcctcgaccgcctgatcatgatcatggccggccgccagtccctgcgcgacacc
atcgctttcccgaaaacgtcgtctgcgtccgacctgatgacccaggcgccgtcgccggtc
gtcaccgaacagctcgacaccctgcacatcgccctgggcgggaaagcattgtccggcgtc
gaaaagcaagaggctgaagaaacagaagcaaaatag

DBGET integrated database retrieval system