KEGG   Tumebacillus avium: CBW65_23880Help
Entry
CBW65_23880       CDS       T04874                                 

Definition
(GenBank) crossover junction endodeoxyribonuclease RuvC
  KO
K01159  crossover junction endodeoxyribonuclease RuvC [EC:3.1.22.4]
Organism
tum  Tumebacillus avium
Pathway
tum03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tum00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CBW65_23880
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tum03400]
    CBW65_23880
Enzymes [BR:tum01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.4  crossover junction endodeoxyribonuclease
     CBW65_23880
DNA repair and recombination proteins [BR:tum03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CBW65_23880
    RecFOR pathway proteins
     CBW65_23880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvC DUF1565
Motif
Other DBs
NCBI-ProteinID: ARU63723
UniProt: A0A1Y0IWK6
Position
complement(5236654..5237157)
Genome map
AA seq 167 aa AA seqDB search
MRILGIDPGYGRTGYGVVDLIGNRLKPVEYGCVETKPNTPIPDRLVEIYGAIREIIKRHQ
PDAMAVEQIFFAKSVTTALDVAQARGVVLLAAREAGLAVAEYTPMQVKQSVVGYGKAEKK
QIQEMVRMLLGLSKIPKPDDAADGLAIAITHAHTAPLQSLAERKLKQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcggatacttggaatcgaccccggatacggtcgaaccggatacggcgtggtcgatttg
atcggcaaccgattgaaacctgtggagtacgggtgtgtggagacgaagcccaacacgccg
attcccgatcggctggtcgagatatacggcgccattcgtgagatcatcaagaggcatcag
cctgatgcgatggcggtggaacagattttcttcgccaagagcgtaacgactgcgctcgat
gtggcccaagcgcgcggcgtggtgctgctcgcagcccgcgaggccggtctcgcagtcgca
gaatatacaccgatgcaagtcaagcaatcggtcgtcggctacggaaaagccgaaaagaaa
cagattcaggagatggtgcgcatgctgcttgggctctccaagatccccaagcctgacgat
gcggcagacggcttggcgattgcgatcacccacgcgcacaccgctccgctgcaaagcctt
gcggaaaggaagttgaagcagtga

DBGET integrated database retrieval system