KEGG   Tupaia chinensis (Chinese tree shrew): 102468757Help
Entry
102468757         CDS       T02978                                 

Gene name
NLN
Definition
(RefSeq) neurolysin
  KO
K01393  neurolysin [EC:3.4.24.16]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    102468757 (NLN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102468757 (NLN)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     102468757 (NLN)
Peptidases and inhibitors [BR:tup01002]
 Metallo peptidases
  Family M3
   102468757 (NLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3
Motif
Other DBs
NCBI-GeneID: 102468757
NCBI-ProteinID: XP_006170985
Position
Un
AA seq 704 aa AA seqDB search
MIARCLWAVRRLPRIGGSRILLRMTLGREVMSPLQALSSSTAAGRNVLRWDLSPEQIKAR
TEELIVQTKQVYDAVGLLDVEEVTYENCLQTLAEVEVKYIVERTMLDFPQHVSSDKDVRA
ASTEADKRLSRFDIEMSMREDIFQRIVHLQETCDLGMIKPEARRYLEKSVKMGKRNGLHL
PEQVQNEIKSMKKRMSELCIDFNKNLNEDDTFLVFSRPELGTLPDDFIDSLEKTDDDKYK
ITLKYPHYFPVMKKCCVPETRRRMEMAFNTRCKEENTAILQQLLPLRAKVAKLLGYSTHA
DFVLEMNTAKSTSRVTTFLDDLSQKLKPLGEAEREFILSLKKKECEERSFDYDGKINAWD
LHYYMTQTEELKYSVDQEFLKEYFPIEVVTEGLLSIYQELLGLSFEQVEDAHVWNKSVTL
YTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMSVAALVVNFSQPV
AGRPSLLRHDEVRTFFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDID
SLRKLSKHYKDGSPISDDLLEKLVASRLVNTGLLTLRQIVLSKVDQSLHTNPSLDAASEY
AKYCTEILGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPE
VGMKYRNLILKPGGSLDGMDMLQNFLQREPNQKAFLMSRGLHAP
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcccggtgcctgtgggctgtgcgacgcctccccagaatcggtggctccaggatt
ttactcagaatgacattaggaagagaagtgatgtctcctcttcaggcactgtcttcctcc
actgcagctggcagaaatgttttaagatgggatctctcaccagagcaaattaaagcaaga
actgaggagctcattgtgcagacaaagcaggtgtacgatgcggttgggctgctcgacgtt
gaggaagtgacatacgagaactgtctgcagacgctggcagaggtagaagtgaagtatata
gtggaaagaaccatgctagactttcctcagcacgtatcctctgacaaagacgtacgggca
gcaagcacagaagcagacaaaagactttctcgttttgatattgagatgagcatgagagaa
gatatatttcaaaggattgtccatctacaggaaacctgtgacctggggatgataaagcca
gaagccagacgatacttggaaaagtcagttaaaatgggaaaaaggaatggactccatctt
ccagaacaagtacagaatgaaatcaaatccatgaagaaaagaatgagtgagctatgcatt
gactttaacaaaaaccttaatgaagatgatacctttcttgtattttccaggcctgaactt
ggtactcttcctgatgatttcattgacagtttagaaaagacagatgatgacaagtataaa
attaccttaaaatatccacactattttcctgtcatgaagaaatgttgtgtccctgaaacc
agaaggaggatggaaatggcttttaatacaaggtgcaaagaggaaaacaccgccattctg
cagcagctactcccattgcgggccaaagtggccaaactccttggctacagcacacatgct
gactttgtccttgaaatgaacaccgcaaagagcacaagccgcgtaacaaccttcctagat
gacttaagccagaaattaaaacccttgggtgaggcagaacgagagtttattctgagtttg
aagaaaaaggaatgtgaagaaagaagtttcgattatgatgggaaaatcaatgcctgggac
ctgcattactacatgactcagactgaagaactcaagtactctgtagaccaagagttcctc
aaagagtacttcccaattgaggtggtcactgaaggcttgctgagcatctaccaggagttg
ttgggactctcttttgagcaagtggaagatgctcatgtttggaataaaagtgttactctt
tacaccgtgaaagataaagctacaggagaagtattggggcagttctacttggacctctat
ccaagggaaggaaaatacaatcacgcagcctgctttggtcttcagcctggctgccttctc
cctgatgggagtcggatgatgtctgtggctgccctggtggtgaacttctcccagccagta
gcaggtcgtccctctctcctgaggcacgacgaggtgaggactttcttccatgagttcggt
catgtcatgcatcagatttgtgcacagactgattttgcacgatttagtggaacaaatgtg
gaaactgattttgtagaggtaccatcacaaatgcttgaaaattgggtgtgggacattgat
tccctccgaaaattatcgaaacattacaaagatggaagccctatttcagatgatctgctt
gaaaaacttgttgcttctagactggtcaacacaggtcttctaactctacgccagattgtt
ttgagcaaagttgatcagtctctccataccaacccatcactagatgctgcaagtgaatat
gccaagtattgcacagaaattttaggtgttgcagctactccaggcacaaatatgccagct
acttttggacatttggcagggggatacgatggccaatattatggatatctttggagtgaa
gtcttttccatggacatgttttacagctgctttaaaaaagaagggataatgaatccagag
gttggaatgaaatacagaaacctaatcctgaaacccgggggatctctggacggcatggac
atgctccagaatttcttgcaacgtgagccaaaccaaaaagcattcctaatgagtcgaggc
ctgcacgctccgtaa

DBGET integrated database retrieval system