KEGG   Tupaia chinensis (Chinese tree shrew): 102469167Help
Entry
102469167         CDS       T02978                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04072  Phospholipase D signaling pathway
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04520  Adherens junction
tup04910  Insulin signaling pathway
tup04913  Ovarian steroidogenesis
tup04923  Regulation of lipolysis in adipocytes
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease (NAFLD)
tup04960  Aldosterone-regulated sodium reabsorption
Module
tup_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102469167 (INSR)
   04015 Rap1 signaling pathway
    102469167 (INSR)
   04010 MAPK signaling pathway
    102469167 (INSR)
   04066 HIF-1 signaling pathway
    102469167 (INSR)
   04068 FoxO signaling pathway
    102469167 (INSR)
   04072 Phospholipase D signaling pathway
    102469167 (INSR)
   04022 cGMP - PKG signaling pathway
    102469167 (INSR)
   04151 PI3K-Akt signaling pathway
    102469167 (INSR)
   04152 AMPK signaling pathway
    102469167 (INSR)
   04150 mTOR signaling pathway
    102469167 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102469167 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102469167 (INSR)
   04923 Regulation of lipolysis in adipocyte
    102469167 (INSR)
   04913 Ovarian Steroidogenesis
    102469167 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102469167 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    102469167 (INSR)
   04213 Longevity regulating pathway - multiple species
    102469167 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102469167 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102469167 (INSR)
   04931 Insulin resistance
    102469167 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102469167 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:tup04090]
    102469167 (INSR)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102469167 (INSR)
Protein kinases [BR:tup01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   102469167 (INSR)
CD molecules [BR:tup04090]
 Proteins
  102469167 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 102469167
NCBI-ProteinID: XP_014440403
Position
Un
AA seq 1382 aa AA seqDB search
MGAGDRRGAAAAPLLVAVAALLVGAAGHLYPGEVCPGMDIRNNLTRLRELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMSITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTSCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSEPNDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHNKCKNSRKQG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVVNGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRVIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIAPKTNGDQASCENELLKFSHIRTSSDKILLKWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQNQPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELYELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKTSPGTGAEDTRPSRKRRSLGDVGNVTVAIPTVPGF
PNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDVPEERCSVAVYI
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQGPKEPNGLIVLYEVSYRRYGDEELHLCV
SRKHYALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEATYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNARDIVKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSRGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSDENKAPESEELEME
FEDMESVPLDQSSHCQREEVGGRDGGSSLGLKRNYEEHIPYTHMNGGKKNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccggggaccggcggggggcggcggccgcgccgctgctggtggcggtggccgcg
ctgttggtgggcgccgcgggacacctgtaccccggagaggtgtgtcccggcatggatatt
cggaacaacctcaccaggctgcgtgaactggagaactgctccgtcatcgaaggacacttg
cagatcctcctgatgttcaagaccaggcccgaagacttccgggacctcagtttccccaaa
ctcatcatgatcaccgactacttgctgctcttccgggtctacgggctcgagagcctgaag
gacctgttccccaacctcaccgtcatccggggctcccgcctcttcttcaactacgcgctg
gtcatcttcgagatggtccacctcaaggagctgggcctgtacaacctcatgagtatcacg
cggggctccgtccgcatcgagaagaacaacgagctctgctacctggccaccatcgactgg
tcccggatcctggattccgtggaggataattacatcgtgttgaacaaggacgacaatgag
gagtgtggggacatctgtccaggcaccgcgaagggcaagaccagctgccccgccacggtc
atcaacgggcagtttgtcgagcgatgttggacacacagccattgccagaaagtctgtccc
accatctgcaagtcgcatgggtgcaccgccgaaggcctctgctgccacagcgaatgcttg
ggcaactgttcggagcccaacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggccggtgtgtggagacctgcccgcctccgtactaccacttccaggactggcgctgc
gtgaacttcagcttctgccaggacctgcataacaagtgcaagaactcccggaagcagggc
tgccaccagtacgtcattcacaacaacaagtgcatccccgagtgtccctccgggtacacc
atgaactccagcaacctgatgtgcaccccgtgcctgggcccctgccccaaggtctgtcac
ctcctagaaggcgagaagaccattgactcggtgacgtcggcccaggagctccgaggctgc
accgtcgtcaacggcagcctgatcatcaacatcagaggaggcaacaacctggctgcagag
ctggaggccaacctgggcctcatcgaagagatctcggggtatctcaaaatccgccgatcc
tacgccctcgtgtctctttccttcttccggaagttacgcgtgattcgaggagagaccctg
gaaatcgggaactactccttctatgccttggacaaccagaacctaaggcagctgtgggac
tggagcaagcacaacctcaccatcactcagggcaaactgttcttccactacaaccccaaa
ctctgcctgtcagaaattcacaagatggaagaagtttccggaaccaaggggcgccaggag
aggaacgacatcgctccgaagaccaatggggaccaggcatcctgtgaaaatgagttactt
aagttttctcacattcgaacttcctcggacaagatcttgctgaagtgggagccttactgg
ccccccgacttccgagacctcttggggttcatgctcttttacaaagaggccccgtatcag
aatgtgacagagttcgacgggcaggatgcgtgcggctccaacagctggacggtggtggac
atcgaccccccgcagaggtccaatgaccccaagtcacagaaccagcccgggtggctgatg
cggggcctgaagccctggacccagtacgccatctttgtcaagaccctggtcaccttctct
gacgagcggcgcacctacggggccaagagcgacatcatttatgtccagacagacgccacc
aacccttccgtccccctggacccgatctcggtgtctaattcctcatcccagattatcctg
aagtggaagcccccctccgacccgaacggcaacatcacccactatctggtgttctgggag
aggcaggcggaggacagcgagctgtatgagttggattattgcctcaaagggttgaagctg
ccctcccggacatggtcgcccccgttcgagtctgaggattcgcagaaacacaatcagagc
gagtacgaggactcggccggcgagtgctgctcctgccccaagaccgactctcagatcctg
aaggagctggaggagtcctcgtttcggaagacgtttgaggattacctgcacaacgtggtc
tttgtgcccagaaaaacctcgccaggcactggggccgaggacactaggccgtcacggaaa
cgcaggtcccttggtgacgtggggaatgtgacggtggccatccccacagtcccgggattc
cccaacacctcctcaaccagcgtgcccacgagccccgaggagcacaggcccttcgagaaa
gtggtgaacaaggagtcgctggttatctcgggcctgcgtcacttcactgggtaccgcatc
gaactgcaggcctgcaatcaagatgtccccgaggagaggtgcagcgtggctgtgtacatc
agtgccaggaccatgcccgaagccaaggcggatgacatcgttggcccagtgacccatgaa
atcttcgagaacaatgtcgttcacttgatgtggcaggggcccaaggaacccaatggtctg
atcgtgctgtatgaagtgagttatcggcgatacggcgacgaggagctgcatctctgtgtc
tcccgaaagcattatgctctggagcgaggctgcaggctgcgtgggctgtcaccagggaac
tacagcgtgagagtccgggctacctccctggcaggcaatggctcctggactgaagccacc
tatttctatgttacagactatttagacgtcccatcaaatattgccaaaattatcattggc
cccctcatctttgtcttcctcttcagtgttgtgattggaagtatttatctattcctgaga
aagaggcagccggacgggccgctggggccgctgtacgcgtcttcaaaccccgagtacctc
agcgccagtgatgtatttccttgttctgtgtacgtgcccgacgagtgggaggtgcctcga
gagaagatcaccctcctgcgagagctggggcaaggctccttcggcatggtgtacgagggc
aacgccagggacattgtcaagggcgaggcggagacccgtgtggcggtgaagacggtcaac
gagtcagccagtctccgcgagcggatcgagttcctcaacgaggcgtcggtcatgaagggg
ttcacctgccaccacgtggtccgcctcctgggggtggtgtccaggggccagccgacactg
gtagtgatggagctgatggctcacggagacctgaagagctatctccgttctctgcggcct
gaagctgagaataacccgggtcgtcctccccctaccctgcaagagatgatccagatggca
gcagagattgcggatgggatggcatacttgaatgccaagaagtttgtgcaccgggacctg
gcagctcgaaactgcatggttgcccacgattttaccgtcaaaattggagactttggaatg
accagagacatctatgaaacggattactaccggaaagggggcaagggtctgctccctgtg
cggtggatggcaccagaatccctgaaggatggggtcttcactacttcttctgacatgtgg
tcctttggtgtggtcctttgggagatcaccagcttggccgaacagccttaccaggggctg
tctaatgagcaggtgttgaaatttgtcatggatggagggtatctggatcaacccgacaat
tgtccagagagagtcactgacctgatgcgcatgtgctggcagttcaaccccaaaatgcga
ccgaccttcctggagattgtcaacctgctcaaggacgacctgcaccccagctttccagaa
gtttccttcttccacagtgatgagaacaaggctcctgagagcgaggagctagagatggaa
tttgaggacatggaaagcgtccccctggaccagtcctcacactgtcagagggaggaggtg
gggggccgggatggcgggtcctcactgggcctcaagcggaactatgaagagcatatcccc
tacacccacatgaatggaggcaagaaaaatggacggattctgaccctgcctcggtcgaat
ccttcctaa

DBGET integrated database retrieval system