KEGG   Tupaia chinensis (Chinese tree shrew): 102470647Help
Entry
102470647         CDS       T02978                                 

Gene name
PLA2G4F
Definition
(RefSeq) phospholipase A2 group IVF
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04010  MAPK signaling pathway
tup04014  Ras signaling pathway
tup04072  Phospholipase D signaling pathway
tup04217  Necroptosis
tup04270  Vascular smooth muscle contraction
tup04370  VEGF signaling pathway
tup04611  Platelet activation
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04724  Glutamatergic synapse
tup04726  Serotonergic synapse
tup04730  Long-term depression
tup04750  Inflammatory mediator regulation of TRP channels
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04921  Oxytocin signaling pathway
tup05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102470647 (PLA2G4F)
   00565 Ether lipid metabolism
    102470647 (PLA2G4F)
   00590 Arachidonic acid metabolism
    102470647 (PLA2G4F)
   00591 Linoleic acid metabolism
    102470647 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    102470647 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102470647 (PLA2G4F)
   04010 MAPK signaling pathway
    102470647 (PLA2G4F)
   04370 VEGF signaling pathway
    102470647 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    102470647 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102470647 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102470647 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    102470647 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    102470647 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102470647 (PLA2G4F)
   04913 Ovarian steroidogenesis
    102470647 (PLA2G4F)
   04921 Oxytocin signaling pathway
    102470647 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102470647 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    102470647 (PLA2G4F)
   04726 Serotonergic synapse
    102470647 (PLA2G4F)
   04730 Long-term depression
    102470647 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102470647 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102470647 (PLA2G4F)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102470647 (PLA2G4F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 102470647
NCBI-ProteinID: XP_006158715
Position
Un
AA seq 850 aa AA seqDB search
MLWALWPRWLVGKGLPLLGAVPLWKRKKRGPQWRHWRQETHPYYDLQVKVLRARNIRGTD
LLSKADCYVQLWLPTASPSPAQTRTVANCSDPEWNETFCYQIHGAVKNVLELTLYDKDVL
SSDQLSSLLFDLRSLKPGQPHRHTFLLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAQ
PCLKIQGTIRADGTAPHREYGSRQIQLAVPGAYEKPQLLPLQPPVEPGLPATFTFHVNPA
LNPTLDVELGEKLTVLQSGPSAELEAQTSKLGEGHILLSSLPLGQEQQHLVALDEGQEVA
LSVKTEMSSGDLDLRLGFDLCDGEQEFLDKRKQVVSKALQQALGLSEAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQDLGLLDTVTYLSGVSGSTWCISTLYKDPAWSQVALQGPIA
RARTRVCSSKMGAMSTERLQYYTQELGARESSGHGVSLIDFWGLLIEYFLYQEENPAKLS
DQQEVISQGQNPFPIYASVNVRTNISGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSEFY
MGRLLQLRPEPRICYLQGMWGSAFAASLDEIFQKTAGSGLGFLDWHRGSVNVTEDDCPKL
QLHDPARLRTRLFTPQGPFSQAVLDIFTSRFTSAENFNFTWGLCLHKDYVAGREFVAWKD
THPDAFPNQLTPMRNCLYLVDGGFAINSPFPLALLPQRAVDLILSFDYSLGAPFEVLQMT
EKYCLDRGIPFPRIEVGPEDLEEPRECYLFAKADDPRSPIVLHFPLVNRTFRTHLAPGVE
RQTTEEKAFGDFVIGGPDTPYGMTNFTYEPEEFDRLVALSRYNVLNNVEAVRQALQLALD
RRQAAERVGG
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcactctggccgagatggctggtgggcaaggggctgcccctcctgggggca
gtgccactgtggaagagaaagaagaggggacctcagtggaggcactggcggcaggaaacc
cacccatactatgacctccaggtgaaggtgctgagggccagaaatatccggggcacggac
ctgctgtccaaagctgactgctatgtacagctatggctgcccacagcgtccccaagtccc
gcccagacaaggacagtggctaattgtagtgaccctgagtggaatgagaccttctgctac
cagatccatggggctgtgaagaatgtcctggagctcaccctctatgacaaggatgtcctg
agcagtgaccaactctcctcgctcctgtttgacctgaggagcctcaaacctggccagccc
cacaggcacaccttcctactcaaccaccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaggtcatcaccaacggggtcctggtggctcag
ccctgtctgaaaatccagggcaccatcagggcagatgggacagccccacaccgggagtat
ggctctaggcagattcagctggcagtgcctggggcctacgagaagccacagctcttgccc
ctgcagcctcccgtggagccgggtctcccggccacctttaccttccacgtgaatccagcg
ctgaaccccacgctggatgtggagctgggggagaagctcacggttctacagagtggcccg
agtgcggagctggaggctcagaccagcaaactgggcgaggggcacatcttgctctcatct
ctgcccctcggccaggagcagcagcacttggtggccctggatgagggccaggaggtggcg
ctaagtgtgaagacagagatgagctctggggacctggacctgcgcctcggctttgacctc
tgtgatggggagcaggagtttttggacaagaggaagcaggttgtgtccaaggccctgcag
caagcactgggactgagtgaggctccggatagtggccaggtacctgtggtggctgtgctg
ggttccgggggtgggacccgagctatgtcttccctgtacggcagcctggcggggctgcag
gatctcggcctcctggacacagtgacttacctgagcggggtgtctgggtctacgtggtgc
atctccacactctacaaggacccagcctggtcccaggtggccttgcagggccccattgca
cgtgcccggactcgggtctgcagcagtaagatgggggctatgtccacagagcggctacaa
tattacacccaggaactgggggcccgagagagcagcggccacggcgtgtccctcattgac
ttctggggtctcctcatcgagtatttcctgtaccaggaggaaaaccctgccaagctatct
gaccagcaggaagtcatcagccaaggccagaaccctttccccatttacgccagtgtcaac
gtccgcaccaacatcagtggggaagactttgcagagtggtgtgagtttaccccctatgag
gtcggcttccccaagtatggggcttacgtccccactgagctctttggctcagagttctat
atgggacgcctgctgcagcttcgacctgagccccggatctgctacctgcagggtatgtgg
ggcagcgccttcgcagccagcctggatgagatcttccagaagacggctggctcaggcctt
ggcttcttggactggcacagaggcagcgtcaacgtcacagaggatgactgcccaaagctc
cagcttcacgaccctgctcgactgcgaacgaggctcttcaccccgcagggtcccttctcc
caggctgtgctggacatattcacctcccgcttcacttccgctgagaacttcaacttcacc
tggggcctctgcctgcacaaagactacgtggctggcagggagtttgtggcctggaaagac
acacacccggacgccttcccgaaccagctcactcccatgcggaactgcctgtacctggtg
gacggaggcttcgccatcaactctccctttccgctggccctgctgccgcagagagcagtg
gacctcatcctgtccttcgactactccttgggagccccattcgaggtcttacagatgaca
gagaagtactgcctggaccgagggatccccttccccaggattgaggtgggccccgaggac
ttggaggagccccgcgagtgctatctgtttgccaaggctgacgacccccgctcacccatc
gtgttgcacttcccccttgtcaatcgaaccttccgcacacacctggccccaggtgtggag
cggcaaacaactgaggagaaggcctttggggattttgtcattggtgggccagacaccccg
tatggcatgacgaacttcacctacgagcccgaggagttcgatcggctggtggccctgagt
cgatacaatgtcctgaacaatgtggaggccgtgaggcaggccctccagctggctctggac
cggcggcaggctgcggagagggttgggggctga

DBGET integrated database retrieval system