KEGG   Tupaia chinensis (Chinese tree shrew): 102473007
Entry
102473007         CDS       T02978                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102473007 (ERAP1)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102473007 (ERAP1)
Peptidases and inhibitors [BR:tup01002]
 Metallo peptidases
  Family M1
   102473007 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102473007
NCBI-ProteinID: XP_006169923
Position
Un
AA seq 1036 aa
MRRWTAGFGRGNALPAFRGQGGGRGWINAGGVASWTSRPLVSSRSLHSLLLRCLPLVLAP
LFTLAGAEVYSDKALRLEQIEVSYLGVSHARFQGSLSKKMVSRPFAAMSFLSLLLTLLTM
STPSWCQSPEATAPKASNGMPFPWNKVRLPEHVVPVHYDLMIHANLTTLAFWGTTEVEVT
VSQPTSTIILHSHHLQIAKATLRKGAGERPSEEPLRVLEYPPHEQIALLAPEPLLVGLPY
TVVIDYAGNLSENFRGFYKSTYRTKDGEVRILASTQFEPTAARMAFPCFDEPALKATFSI
KIRREPRHLAISNMPLVKSVTIAEGLIEDHFDVTVKMSTYLVAFIISDFKSVSKMTKSGV
KVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIPYPLPKQDLAAIPDFQSGAMENWGLT
TYRESALLYDAEKSSASSKLGITMTVSHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEYV
SVSVTHPELKVEDYFFGKCFSAMEVDALNSSHPISTPVENPAQIREMFDDVSYEKGACIL
NMLRDYLSADAFKNGIIQYLQKYSYKNTKNEDLWNSMASICPTDNTQTTDGFCSRSQHSS
SSSHWRQEGLDVRSMMNTWTLQKGFPLVTVTVRGRNVHVRQEHYMKGSDGVPETGYLWHV
PLTFITSKSDVVQRFLLKTKTDVLILPEEVEWIKFNVGMNGYYIVHYEDDGWDSLAGLLK
GTHTAISSNDRASLINNAFQLVSVGKLSIEKALDLILYLKYETEIMPVFQGLDELIPMYK
LMEKRDMNEVETQFKAFLIKLLKALIDKQTWTDDGSVSERMLRSQLLLLACVRKYQPCVQ
KAEDYFRKWKESSGDLRLPDDVTLAVFAVAAQNTEGWDFLYSKYQSSLSNEEKNQIEFAL
CTSQDKEKLQWLLDESFKGDIIKTQEFPHILGLIGRNPVGYPLAWQFLRENWNKIVQKFE
LGSPSIAYMVMRTTNQFSTRTRLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKN
FDKIRAWLQTEKLELL
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgcgcaggtggacggcggggttcggccgagggaacgccttgcctgcctttaggggccag
ggaggaggccgtggctggattaatgcgggaggggtggcgagttggactagcaggccgctg
gtgtcctcaaggtcacttcactccctgctcctgcgctgcttacccttggttcttgctccc
ctcttcaccctggctggagctgaggtttactcagataaagctctcaggttggagcaaatt
gaagtttcctatctgggggtctcacacgccaggtttcaaggtagtttaagcaagaagatg
gtatctcgtccctttgcagccatgtcatttctgtctttactgttgactcttttaactatg
tcaactccttcgtggtgtcagagccctgaagctacagctcctaaagctagtaatgggatg
ccctttccttggaataaagtgcgacttcctgagcatgtcgtcccagttcattatgatctc
atgatccatgcaaatctcaccacgctggctttctggggaaccacagaagtcgaagtcacc
gtcagccagcccaccagtaccatcattctgcacagtcaccacctgcagatcgccaaggcc
accctccggaaaggagctggagagaggccctccgaagaaccgctgcgggtcctggaatac
ccccctcatgaacaaatcgcgcttctggccccagagcctctcctcgttgggctcccgtac
acagttgtcattgactatgctggtaatctctctgagaacttccgtggattttataaaagt
acctacagaaccaaggatggggaagtgaggatacttgcatcaacacagtttgaacctact
gccgctagaatggcctttccctgcttcgatgaacctgccctcaaagcgacgttctcaatc
aagatcagaagggagcccaggcacctcgccatctccaacatgccactggtgaaatctgtg
acgattgccgaaggactcatagaagaccattttgatgtcactgtgaagatgagtacctac
ctggtggccttcatcatttcagattttaagtctgtcagcaagatgaccaagagtggtgtc
aaggtttcggtatatgctgtaccagacaagataaatcaagctgattacgcactggatgct
gctgtaactcttctagaattttacgaggattatttcagcattccatatcccttacccaaa
caagatcttgctgctattcccgattttcagtctggtgctatggaaaactggggactgacg
acgtacagagaatctgctctgctgtatgatgcagaaaagtcttctgcgtccagtaaactc
ggcatcacaatgactgtgtcccacgagctcgcccaccagtggtttggaaatttggtcact
atggaatggtggaatgatctttggctaaatgagggatttgccaagtttatggaatacgtg
tctgtcagtgtgacccatcctgaactgaaagttgaagattatttctttggtaaatgtttc
agtgcgatggaggtagatgccttaaattcttcacaccccatttccacacctgtggagaat
ccagctcagattcgggagatgtttgatgacgtgtcttatgaaaagggagcttgtattttg
aatatgctaagggattatctttctgccgatgcatttaaaaatggcattatacagtacctc
cagaagtatagctataaaaacacaaaaaacgaggacctctggaatagcatggcaagtatt
tgtcctactgataacacgcaaacaacagatggcttttgttctagaagtcaacattcatct
tcatcctcacactggcgtcaggaaggcctggatgtgagaagcatgatgaacacctggacg
ctgcaaaagggctttcctctggtaaccgtcacagtaagagggaggaacgtgcatgtgagg
caagagcactatatgaagggatctgacggtgtcccggagactgggtacctgtggcatgtt
ccattgacattcattaccagcaaatcagatgtggtccagagattcttgctgaagaccaaa
acagatgtgctcatcctccccgaagaggtggaatggatcaaatttaatgtgggaatgaac
ggctattacatcgtgcattacgaggatgacggatgggattctttggctggccttttaaaa
ggaacacacacggcaatcagcagcaatgatcgggcgagtctcattaacaatgcatttcag
cttgtcagcgttggaaaactatccattgaaaaagctttggatttaatcctgtacttgaaa
tatgaaactgaaattatgcctgtgttccaaggtttggatgaactgatacctatgtataag
ctaatggaaaaaagagacatgaatgaagtagaaactcaattcaaggccttcctcatcaag
ctgctgaaggccctcattgataagcagacatggacggatgatggctcggtctcggagcga
atgctgcggagtcagctcctcctccttgcctgtgtgcgcaagtatcagccatgtgtgcag
aaggcagaagactatttcagaaagtggaaggaatccagtggagatctgagactgcctgac
gatgtgaccttggcagtgtttgctgtggcggcccagaacaccgaaggctgggattttctt
tatagtaaatatcagtcgtctttgtctaatgaagagaaaaaccaaattgaatttgccctg
tgtaccagccaagataaagaaaagcttcagtggctactagatgaaagctttaagggagat
ataataaaaactcaggagtttccacatattcttggcttaattggcagaaaccctgtgggc
tatccacttgcctggcaatttctgagggaaaattggaacaaaattgtacaaaagtttgaa
cttggatcaccttccatagcctacatggtaatgaggacaacaaatcaattctccacgaga
acacggcttgaagaggtaaaaggattcttcagctctttgaaagaaaacggttctcagctt
cgttgtgtccaacaaacaattgaaaccattgaagaaaacatacgctggatggataagaat
tttgataaaatcagagcatggctgcaaactgaaaagcttgaactgctgtaa

DBGET integrated database retrieval system