KEGG   Tupaia chinensis (Chinese tree shrew): 102473333Help
Entry
102473333         CDS       T02978                                 

Gene name
PLA2G4C
Definition
(RefSeq) phospholipase A2 group IVC
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04010  MAPK signaling pathway
tup04014  Ras signaling pathway
tup04072  Phospholipase D signaling pathway
tup04217  Necroptosis
tup04270  Vascular smooth muscle contraction
tup04370  VEGF signaling pathway
tup04611  Platelet activation
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04724  Glutamatergic synapse
tup04726  Serotonergic synapse
tup04730  Long-term depression
tup04750  Inflammatory mediator regulation of TRP channels
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04921  Oxytocin signaling pathway
tup05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102473333 (PLA2G4C)
   00565 Ether lipid metabolism
    102473333 (PLA2G4C)
   00590 Arachidonic acid metabolism
    102473333 (PLA2G4C)
   00591 Linoleic acid metabolism
    102473333 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    102473333 (PLA2G4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102473333 (PLA2G4C)
   04010 MAPK signaling pathway
    102473333 (PLA2G4C)
   04370 VEGF signaling pathway
    102473333 (PLA2G4C)
   04072 Phospholipase D signaling pathway
    102473333 (PLA2G4C)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102473333 (PLA2G4C)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102473333 (PLA2G4C)
   04664 Fc epsilon RI signaling pathway
    102473333 (PLA2G4C)
   04666 Fc gamma R-mediated phagocytosis
    102473333 (PLA2G4C)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102473333 (PLA2G4C)
   04913 Ovarian steroidogenesis
    102473333 (PLA2G4C)
   04921 Oxytocin signaling pathway
    102473333 (PLA2G4C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102473333 (PLA2G4C)
  09156 Nervous system
   04724 Glutamatergic synapse
    102473333 (PLA2G4C)
   04726 Serotonergic synapse
    102473333 (PLA2G4C)
   04730 Long-term depression
    102473333 (PLA2G4C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102473333 (PLA2G4C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102473333 (PLA2G4C)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102473333 (PLA2G4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 102473333
NCBI-ProteinID: XP_006142251
Position
Un
AA seq 632 aa AA seqDB search
MLKTGPCSPAMLLPRNPRHLEPLSPGSSSRGPENLPTTVDMESAEVSIIPGLQKEEKAAV
EKRSPKVLKALKKLSIQANEAPVIAMLGSGGGLRAHIACLGVLSEMREQGLLDAVMYLAA
VSGSTWAMSSFYTNSGDTKAIEAELKRRFDQKEWDLDKSLEKTVKAAKLENYSLTDFWAY
LVVSKQTRELQDSCLSSMKKQVEDGTLPYPIFAAIDDDLQTAWERKKAQKTWFEFTPHHA
GYPALGAYVPTTHFGSKFKEGRLIKSESERDLTFLKGLWGSALASTKDMKKFILAQFLSL
KEKLKMNYLSKEGTGVDEALLELVTAYLQDQSSNSTQRRLQTLQQALQVERPDQDSEPEH
AWLAKMVQNWSQMSWEEQGRLLESLVCSFTGQGGLPMPRIRSTIKESLKDFLDFLNKTGV
CFWKWEWGTIHNFLYEHGGIRDEAMHSRELLHLVDAGVAINTPYPLVLPPMREVHLILSF
DFSAGDPFETIRAAADYCHQNKIPFPPVEEAKLEAWSKAPADCYILKGETGPVVMHFPLF
NTDTCGDEIQMWNDRYSTFKLVDSYTLDLVTQLLEVSKNNIRRNKENILREMRNVVREPP
KFLEVNKDSLEDMVEDVEGSQAMEIKITHTTA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaaccggcccttgttctccagccatgcttcttcctaggaatcctagacacttg
gaacccctgtcgcctgggtcgagtagcagagggcctgagaatctcccgaccacagtggac
atggaaagtgctgaggtctccataattcctggactccagaaagaagagaaggcagctgtg
gagaaacgcagccccaaagtgttgaaggctctgaaaaagctaagcatccaggccaatgag
gccccagtgattgccatgctgggctcaggaggggggctgcgggcccacatcgcctgtctc
ggggtcctgagtgagatgagagaacagggcctgttggatgctgtcatgtacctcgcagca
gtctctggatccacttgggcaatgtcttcattctataccaatagtggtgacacaaaagct
atcgaggctgagctgaaacgtcgatttgaccagaaagagtgggacttggacaagagcctg
gagaagactgttaaagcagcaaagttggagaattactctctgactgacttttgggcctac
ctggttgtctccaagcaaaccagagaactgcaggactcctgtttgtccagcatgaaaaaa
caagtggaagatgggacactgccctacccaatatttgcagccattgacgacgacctccaa
actgcatgggagaggaaaaaggcccagaagacctggtttgagttcacccctcaccacgct
ggctaccctgcactcggtgcctacgtccctactacccactttggaagcaaattcaaggag
ggaagactgattaagtctgagtctgaacgagacctgacctttctgaaaggtttgtgggga
agtgctctagctagcaccaaagacatgaagaagttcattttggcccagtttctaagcttg
aaagaaaaattgaaaatgaactatctatccaaagaaggcacaggcgtggacgaagctctg
ctggaactggtgacggcttacttacaggatcagagcagcaacagcacccagaggaggctg
cagaccctgcagcaggcactgcaggtggaaaggccagatcaagacagcgagcctgaacac
gcctggctggccaagatggttcagaactggagccagatgtcctgggaagagcaggggcgg
ctcctggagtccctggtgtgtagcttcacagggcaaggagggcttcccatgccccgcatc
aggagcacaatcaaggagtcgctcaaggactttttggactttctgaataaaaccggagta
tgcttttggaagtgggaatgggggaccattcacaactttctgtacgaacatggtggcatc
agagatgaggcgatgcacagtcgggaactcctccacctggtcgatgctggggttgccatc
aacactccctacccactggtcctgcccccgatgcgggaggtccacctcatcctctccttt
gactttagtgccggggatccttttgagaccatcagggctgctgctgactattgccaccag
aacaaaattcccttccccccagtagaagaggctaagttggaggcgtggtccaaagccccg
gctgactgctacatcctgaaaggggaaaccggtcctgtcgtgatgcattttcccctgttc
aacacagacacctgtggagatgaaattcagatgtggaatgacagatacagcaccttcaaa
ctcgttgacagctatactctagacctggtgacacagctcctggaggtgtccaagaacaac
atcaggagaaacaaggagaatatcctcagagagatgaggaatgtggtcagagaacccccg
aagttcctagaggttaacaaggattcactggaggatatggtggaggatgttgaaggctct
caagctatggaaatcaagatcacccacaccacagcatga

DBGET integrated database retrieval system