KEGG   Tupaia chinensis (Chinese tree shrew): 102473985Help
Entry
102473985         CDS       T02978                                 

Gene name
HDC
Definition
(RefSeq) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00340  Histidine metabolism
tup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    102473985 (HDC)
Enzymes [BR:tup01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     102473985 (HDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102473985
NCBI-ProteinID: XP_006168832
Position
Un
AA seq 665 aa AA seqDB search
MMEPGEYRERGRQMVDYICQYLSTVRERRVTPDVQPGYLRAQLPDSAPEEPESWDNIFGD
IERVIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVM
DWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTTEPNSDESS
LNARLIAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGETLQKAIEEDRQRGLVPVF
VCATLGTTGVCAFDCLSELGPICASEGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFT
FNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPVYLRHANSGVATDFMHWQIPLSRRFRSI
KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRDDPFFEIPAKRHLGLVVFRLKGPNCLT
ESVLKEIAKVGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWSLIQDAATLVLSQHCT
LQPRPQVGNLIPPVSGNRSGTVLVNGVSHQLVNEAGDDPSQARKIIKQPERAGASPMRRK
DSCHLETLLDPFDDCFSEEAPAVAKHKLSSFLFSYLSVQNKKKTVRSLSCNSVPVSAQKP
LPAEGSTKNGGSSRARIFSRFPEEMMMLKKSAFKKLIKFYSVPSFPECGHQCGLQLPCCP
LQAMV
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgatggagcctggggaatacagagagagagggagacagatggtggattacatctgccag
tacctgagcacggtgcgagagaggcgtgtgactccagatgtgcagcctggctacctgcga
gcccagctgcccgacagtgctcctgaggaaccagaaagctgggacaacatcttcggggac
attgagcgggtcatcatgcctggggtggtccattggcagagcccccacatgcacgcctac
tacccagccctcacctcttggccatccctgctaggagacatgctggccgatgccatcaac
tgtttgggattcacttgggcctctagccctgcatgcacagagctggagatgaacgtcatg
gactggctggcgaaaatgctgggactcccagagcacttcctgcaccaccaccccagcagc
caagggggtggcgtcttacagagcacggtcagcgaatccaccttgattgcccttttggca
gcaaggaagaacaaaatcctggaaatgaaaacaaccgagcccaattcagacgagtcctcc
ctgaacgcccggctcattgcctatgcctctgaccaggctcactcctcagtggagaaggct
ggtttgatttctctcgtgaagatgaaatttctgcctgtggatgacaacttctcactccga
ggagaaactcttcagaaggccatcgaggaagataggcagcggggcttggtgcctgtcttt
gtctgtgcaacactagggactactggggtctgtgcgtttgactgcctctcagagctgggc
cccatctgtgccagcgaggggctgtggctccacatcgatgctgcttatgcaggaactgcc
ttcttgtgccctgagttccgggggtttctgaagggcatcgagtatgccgactccttcacc
tttaatccttccaagtggatgatggtgcactttgactgtactgggttctgggtcaaggac
aagtacaagctgcagcagaccttcagtgtgaaccctgtctacctcaggcatgccaactcg
ggcgtagccaccgacttcatgcactggcagatccctctgagccggcgatttcgctctatt
aaactctggttcgtgattcggtccttcggggtgaagaaccttcaagctcatgtcagacat
ggtactgaaatggctaaatattttgaatctctggttagagacgaccctttctttgaaatt
cctgccaagaggcaccttggcctggtggtttttcgtctaaagggtcctaactgtctcaca
gaaagtgtgttaaaggaaatagctaaagtcggccgtctcttcctcatcccggccactatc
caggacaagctgatcattcgcttcactgtgacttcccagtttaccaccagggatgacatc
ctgagagactggagtctcatccaagatgctgccactctggtcctgagtcagcactgtact
ttacagcctcgccctcaagttgggaacctcatccccccagtcagcggcaatagatcaggt
actgtactggtcaacggagtgtcccatcagcttgtcaacgaggcaggagatgacccaagc
caggccaggaagatcatcaagcagcctgagcgtgcgggagccagtcctatgagaaggaag
gacagctgccatcttgaaaccctgctggatccatttgatgactgcttttccgaagaggcc
ccagctgtggccaagcacaagctgtcctccttcctgttcagctacttgtctgtgcagaat
aagaagaagacggttcgttccctcagttgcaacagtgtgcccgtgagtgcacaaaagcct
ctgcccgctgagggctctactaagaatgggggctcctcccgggccagaatcttttccagg
tttccagaggagatgatgatgctgaagaaaagtgccttcaaaaagctcatcaagttctac
agcgtgcccagctttccggagtgcggccatcagtgtgggctccagctgccctgctgccct
ctgcaggccatggtgtag

DBGET integrated database retrieval system