KEGG   Tupaia chinensis (Chinese tree shrew): 102474078
Entry
102474078         CDS       T02978                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102474078 (ADAMTS13)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102474078 (ADAMTS13)
Peptidases and inhibitors [BR:tup01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102474078 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 TSP1_spondin Reprolysin_5 TSP1_CCN Peptidase_M10 DUF4953 Reprolysin_2 Lentiviral_Tat
Other DBs
NCBI-GeneID: 102474078
NCBI-ProteinID: XP_006164344
Position
Un
AA seq 1294 aa
MGALPHRSWVRCRTPCVTYVTCVGRILACASFLLGCWGLSNFQQSFLQALQPEDVLSYFG
PAASLKGHLPLGLQRQRRAAVGILHLELLVAVGPDVFQAHGEDTERYVLTNLNIGSELLR
DPSLGAQFRLHLVKMITLTEPKGAPNITANITSSLLRVCEWSQTVNPADDTDPGHADLVL
YITRFDLELPDGNRQVRGVTQLGGACSPAWSCLITEDTGFDLGVTIAHEIGHSLGLEHDG
APGSDCVPSGHVMAADSAMTTPGGLAWSTCSRQQLQHLLSAGQAHCMRDSPQPQPGPVSR
PPDAQPGLYYGADEQCRVAFGPSAMACTFVKEHLDTCQALSCHTDPLDRSRCSRLLIPLL
DGTECGVEKWCSKGHCRSLAELAPVAAVHGHWSSWGPRSPCSRSCGGGVVTRRRRCNNPR
PAFGGRACIGADLQAEMCNTQACGKTQLDFMSEQCAQTDGQPLHLSPGSASFYHWGSAVQ
YSQGDALCRYVCRAIGESFIVRRGDSFLDGTRCVPSSPQEAGTLSLCVSGRCRTFGCDGR
MDSQQVWDACQVCGGDNSTCSPRSGSFTAGRAREYVTFLTITPNLTSVHIVNRRPLFTHL
GELTRGHSTGGGNKSLSPSTTYPSLLEDGRVEYRVALTEDRPMPRLEEIHIRGPRWEDME
IQVYRRYNDQYGDLTRPDITFTYFQPKQQPAWAWAAVRGPCSVSCGAGLRWVTYSCLDQA
RDTWVEATWCRGNPQPAAWPESCTPKPCSLNLHTSDFREDLASQNVTRAPGARGLEAPAT
AGPCPTDGKPPVLRTCGATACPPGWGDVDAKSPGADSPSGSATPGAPTVHLWTPLAGPCS
VSCGHGLRELRFVCMDSALGMSVQEELCELARKPEGRQEICQAAPCPARWKVLSLGPCSV
SCGLGTASRSVVCTRFARGQDTEVDEAACAALVRPQASVPCLVADCTYRWHVSPWTECSA
SCGDGTQLRHDTCLGLAQEPVPAVFCQHLPKPATVRGCWAGPCVGQGTPSPAPHQEAPDP
GQTSAVPAGASQESSWPLSPAPQPQGPLPWPQERPVEYSACGRQHPEPTGTIDLRGPGQA
DCVVAIGRPLGEVVTLRVLQSSLNCSAGGLLLLWGRLTWRKTCRKLPGMTFSSKTNTLLV
RQRRLQPEGGVLLQYWSRTAPGSYTGCDVQLFGPGGEVVSPSLSADGRKAGGCRLFIDVA
PRARIAIHALTTTTGTGPQGNNASYILIWDTHSLRTTAFRGQQELYWESEGSQAEVEFSE
GFLEMQASLRGRYWTLPSRLPEEDAEREPGRTLP
NT seq 3885 nt   +upstreamnt  +downstreamnt
atgggcgcgcttccccaccgaagctgggtgcgatgccgcaccccgtgtgtgacctatgtg
acctgcgtgggtagaatcctggcttgtgcctcctttctcctgggctgctggggactctcc
aatttccagcagagcttccttcaggctctgcagccggaggacgtgctctcctactttggc
cctgctgcctccctgaaaggccatcttcctcttggcctccagagacaaaggcgggctgca
gtgggcatcctgcatctggagctgctggtggccgtgggccccgatgtcttccaggctcac
ggggaggacacggagcgctacgtgctcaccaacctcaacatcgggtcggaactgctgagg
gacccgtccctgggggctcagttccggctgcacctcgtgaagatgatcactctgacggag
cccaagggtgctccgaacatcacggccaacatcacctcatcactgctgcgtgtctgtgag
tggagccagaccgtcaaccctgcagacgacacggaccctggacacgccgacctggtgctc
tacatcaccaggtttgacctggagctgcctgatggtaaccggcaggttcggggggtcacc
cagctgggaggtgcctgctcccccgcctggagctgcctcatcactgaggacaccggcttc
gacctgggcgtcaccattgcccatgagattggccacagcctcggcttagaacatgatggt
gcaccgggcagtgactgtgtccccagcggccatgtgatggctgcggacagcgccatgacc
acccccgggggcttggcctggtccacctgcagccgccagcagctgcagcacctgctcagc
gcaggccaggcgcactgcatgagggactcaccacagccgcagcctgggcccgtcagtcgc
cctccagacgcacagccgggactctactatggcgctgatgagcagtgccgcgtggccttt
ggccccagcgccatggcctgcacctttgtcaaggagcacctggacacgtgccaggctctg
tcctgccacacagacccactggaccgaagccgctgtagccgcctcctcattcctctcctg
gatgggacagaatgtggtgtggaaaagtggtgctccaagggtcactgccgttccctggcg
gagctggcccccgtggcggccgtgcatgggcactggtctagctggggccctcgcagtcct
tgctcccgctcctgtggaggaggggtggtcaccaggaggcgccgatgcaacaaccccagg
cctgcctttggagggcgtgcgtgcatcggtgctgacctccaggctgagatgtgcaacacc
caggcctgcgggaagacccagctggacttcatgtcagagcagtgtgcccagaccgacggt
cagcctctgcacctctccccaggcagcgcctccttctaccactggggttccgctgtgcag
tacagccaaggggacgctctgtgcaggtacgtgtgccgggccattggtgagagcttcatc
gtgcggcgtggagacagcttcctggatggcacccgctgtgtgcccagcagccctcaggag
gccgggaccctgagcctgtgcgtgtcgggcagatgtaggacgttcggctgtgacggcaga
atggactcccagcaggtgtgggatgcatgccaggtgtgtggaggtgacaacagcacttgc
agcccacggagcggctctttcacagccgggagggccagagaatatgtcacattcctgacg
atcacgcccaacctgaccagtgtgcacatcgtcaaccgcaggcctctcttcacacacctg
ggtgagttgaccagagggcactccaccgggggggggaacaaaagcctctctcccagtacc
acctacccctccctcctggaggacggccgcgtggagtacagagtggccctgaccgaggac
cggccgatgccccggcttgaggagatccacatccgaggaccccgctgggaggacatggag
atccaggtttacaggcggtacaacgaccagtacggcgacctcacccgcccagacatcacc
ttcacctacttccagcctaagcagcagccggcctgggcgtgggccgccgtgcgcgggccc
tgctcggtgagctgtggggcagggctgcgctgggtgacctacagctgcctggaccaggcc
agggacacgtgggtggaggccacctggtgccgagggaacccgcagccggcagcgtggccg
gagtcctgcacccccaagccctgctccctgaaccttcacacgtcagacttcagagaagac
ctggcctcgcaaaatgtgacacgggctccaggagcgaggggactggaagcccctgcgacg
gcgggaccgtgccccacagacgggaagccacctgtcctcaggacttgcggtgcaacggcg
tgtcctccaggctggggtgatgtggacgctaagtctccaggggcggactctccatcaggc
agtgccacgccgggggctcccactgtgcacttgtggacccctctagctgggccctgctcc
gtctcctgtggacacggcttgagggagctgcgttttgtgtgcatggactctgcccttggg
atgtctgtccaggaagagctgtgtgagctggcacgcaagcctgagggccggcaggagatc
tgccaggctgccccatgccctgctcggtggaaagtcctgtcccttggtccgtgctcagtc
agctgtggccttggcactgcgagtcgctctgtggtctgcacacggttcgcccgtggccag
gacactgaggtggacgaggcggcctgtgcagccctggtgcgaccacaggccagcgttccc
tgcctggttgccgactgcacctaccggtggcatgtcagcccgtggacagagtgctccgcc
tcctgtggggatggcacccagctccggcatgacacctgcctcggactggcccaggagccc
gtaccggccgtcttctgccagcacctgcccaagccagcaactgtgcggggctgctgggct
gggccctgtgtaggacaggggacacccagcccggcaccccaccaggaagcccctgatcca
ggccagacctcagctgtccctgctggcgcttcccaggagtcgtcctggcccctctcccca
gctccccagcctcaggggccattgccctggcctcaggaaagacccgtggagtacagtgcc
tgcggcaggcagcacccggagccgacaggaaccatcgacctgcgaggccccgggcaagca
gactgtgtggtggccattgggcggcccctgggcgaagtggtgacgctccgagtcctgcag
agttccctcaactgcagtgcgggggggctgctgctgctctggggccggctcacgtggagg
aaaacatgcaggaagctgcccggcatgactttcagctccaagaccaacacgttgctggtg
aggcagcgccggctgcagcctgaaggtggggtgctgctgcagtactggagcaggaccgcc
ccgggctcttacacaggatgtgacgtgcagctctttggccctgggggggaagttgtgagc
ccctctctgagtgcagatgggaggaaagcagggggctgccggctcttcatcgatgtggcc
cctcgggcccggattgccatccatgccctgaccaccaccacgggcaccggaccccagggg
aacaacgccagctacatcttgatctgggacacccacagcctgaggaccacagcattccgt
gggcagcaggaactgtactgggagtcagagggcagccaggctgaagtggagttcagcgag
ggcttcctggagatgcaggccagcctgcggggccggtactggaccctgccatccaggttg
cctgaagaggacgcagagcgggagcctggcaggaccctgccctga

DBGET integrated database retrieval system