KEGG   Tupaia chinensis (Chinese tree shrew): 102474163
Entry
102474163         CDS       T02978                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102474163 (AKAP5)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102474163 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102474163
NCBI-ProteinID: XP_006142461
UniProt: L9L7E1
Position
Un
AA seq 427 aa
METIGPEIQVENKDEKRSAEGTPQKKQEETASMLCFKRRKKTTKALKPKAGSEAADVAKK
CPSEAGASDQPQHPGGAWASIKCLVTRRKKSGSAKQPKLLEAEVQPAGNAEAAEPSKKKA
KSRLKFPCIKFSRGVKRSNHSKIIEDSDCSVKVQGEAESLDVQTQTQLNNQVTKATLTQD
LDESISQKDGDEVCESNVSNRVTSGEKVISVELGLDNGQSAIQTGTVILEKEIETAEEEQ
SVQPQQASSLENSETDYQPPVVSDVSPSPAIPDQRIVEEASNDILESGSNWKDYDSTVIL
TEENTPKDAELSQESDFKENEPSAEKPKTEESKRMEPIAIIITDTEISEFDAEKSKNVPK
QFLISIENEQVGGFANDSGLEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDDN
KINNLLQ
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggagaccataggtcctgaaattcaagtagaaaacaaggatgagaagagatcagctgaa
ggtactcctcagaagaagcaagaggaaacagcatccatgctttgcttcaagagaagaaag
aaaacgaccaaagctctgaagcccaaagctggctctgaagctgctgatgtggcaaagaag
tgtccctcagaagcaggagcttctgatcagccacagcacccagggggagcctgggcctca
attaaatgccttgtcacacgcaggaaaaagtcaggttctgccaagcagcccaagctgttg
gaggccgaagtgcaaccagcaggaaatgctgaggctgctgagccgtctaagaaaaaggca
aaatccaggctcaagtttccctgcatcaagttctcaagaggggtaaaacgcagtaatcat
tccaaaattatagaggactcagattgcagcgtcaaagtgcagggagaggctgaaagtttg
gatgtacaaactcagacccaactgaataatcaggtcacaaaggctacattgacccaggat
ctggatgaaagcatctcacagaaagatggtgatgaggtctgtgagtcaaacgtgagcaac
cgcgtgacttctggagagaaagtgatttctgtggaacttgggttagacaatgggcaatct
gctattcaaacaggaaccgtaatccttgaaaaagaaattgaaacagctgaggaagaacaa
agtgttcaaccccagcaagcaagctcacttgaaaattcagaaacagactaccagccacct
gtggtttcggatgtttctccttcgcctgcaatcccagatcaacgaattgtggaggaagcc
agtaacgacatcttagaaagtggatcaaattggaaagactatgacagtacagtgattcta
acagaggagaatacgccaaaagatgctgaactgagccaggaatcagattttaaagagaac
gagcccagtgcagagaaacccaagacagaagaaagcaaaagaatggagccaattgctatt
attattacagacacagaaatcagtgaatttgatgctgagaaatctaaaaatgtccctaag
caattcttaatttcaatcgaaaatgagcaagtagggggttttgctaatgacagtggttta
gagggtagaacttcagaacaatatgaaactctcttaatagaaacagcttcttctcttgtc
aaaaatgctatccagttgtctatagaacagctggttaatgaaatggcctctgatgataat
aaaataaacaatcttctacagtga

DBGET integrated database retrieval system