KEGG   Tupaia chinensis (Chinese tree shrew): 102474502Help
Entry
102474502         CDS       T02978                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tup01002]
    102474502 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102474502 (ABHD12)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102474502 (ABHD12)
Peptidases [BR:tup01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102474502 (ABHD12)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102474502 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_3 Thioesterase Abhydrolase_2 DUF1937
Motif
Other DBs
NCBI-GeneID: 102474502
NCBI-ProteinID: XP_006163715
Position
Un
AA seq 400 aa AA seqDB search
MRKRTEPVTLEHERCAASGSSSSGSAAAALDADCRLKQNLRLAGKGPAEPRCAADAGMKR
ALGRRKGLWFRLRKILLCVLGLYVAIPFLIKLCPAIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTCNYYLQPEEDVTIGVWHTVPAVWWKSAQGKDQMWYEDALASSHPIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSIGTPSERGMTYXXXXXXVFEWIKARSGDN
PLYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFD
WFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYNIAAPSRSFRDFK
VQFVPFHSDLGYRHKYIYKSPELPRILRDFLGKPEAERQH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagcccgtcaccttggagcatgagcgctgcgccgcctcgggctcg
tcgtcctccggctcggccgccgcggcgctggacgccgactgccgcctgaagcagaacctg
cgcctggcgggcaaggggccggccgagccgcgctgcgccgccgacgcgggcatgaagcgg
gcgctgggcaggcggaagggcctgtggttccgactgaggaagatactcctctgcgtgctg
gggctgtatgttgccattccatttctcatcaaactgtgtcctgcgatacaggccaaactg
attttcttgaattttgtgagggttccctacttcattgacttgaaaaaaccacaggatcaa
ggtttgaatcacacctgcaattactacctccagccagaggaagacgtgaccataggggtc
tggcacaccgtgcccgccgtctggtggaagagcgcccaagggaaggaccagatgtggtat
gaggacgccctggcttccagccaccccatcattctctacctgcatgggaatgcaggtacc
aggggaggcgaccaccgggtggagctttacaaggtactgagctccctcggttaccacgtg
gtcacctttgactacagaggctggggagactctataggaacaccttccgagcggggcatg
acttacnnnnnnnnnnnnnnnnnngtatttgagtggatcaaagcaaggagcggtgacaac
ccactgtacatttggggccattctctgggcactggggtggcgacaaacctggtgcggcgc
ctctgcgaacgagagacgcctccagatgctcttattttggaatctccattcactaatatc
cgtgaagaagctaagagccatccgttttcagtgatataccgatacttcccgggattcgac
tggttcttcctcgatcccatcacaagcagtggaattaagttcgcaaatgacgaaaatgtg
aagcatatctcctgtcccctgctcatcctgcacgctgaggatgaccccgtcgtgcccttc
cagctcggcagaaagctctacaacatcgctgcaccatctcgaagcttccgagacttcaaa
gtgcagttcgtcccctttcactcagacctcggctacaggcacaagtacatctataagagc
cccgagctcccgcggatactgagggacttcctggggaagccagaagctgagcgccaacac
tga

DBGET integrated database retrieval system