KEGG   Tupaia chinensis (Chinese tree shrew): 102475223
Entry
102475223         CDS       T02978                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Brite
KEGG Orthology (KO) [BR:tup00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tup03021]
    102475223 (AFF3)
Transcription machinery [BR:tup03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102475223 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 102475223
NCBI-ProteinID: XP_014438875
Position
Un
AA seq 1185 aa
MGESIYLMVLKKIQEPYVYEPDRNVLRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNK
GDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQPQ
PSSVCSTASSTPAAVPVQQSKRGTAGWQKAGHPPPDGQQRATQQGSLRTLLGDGVGRQSS
RAKQVCSVDVGLQAQERPPTMAAKHSSGGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQ
DQAPDESPKLKSSTETSVHCPSYRGVPASKPESARAKAKLSKFSIPKQGEESRSGENNSC
VEEIIREMTWLPPLSAIQAPGKVEPSKFPFPNKDSQLVTTGHNNPKKGDAEPESPDNGTS
HTSMLEDDLKLSSDEEENEQQAAQRPTLRALSDSTVVPPPTCRASVPSCKGSSSGSSSSS
SSSSDSESSSGSDSETESSSSESEGSKPPHFSSPEAEPASSNKWQLDKLLNKVNPHKPPI
LIQNESHGPESTQYYPPAKDEVQDGGKLPDVCPASLREKELKSACKEEQRPRTANKAPGS
KGVKQKSPPAAVAVSAAAPPPPALPGAPGESAPAVVVPPEPTKTKPCGNNRTSHRKELRS
SSVACEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQTVATAASS
GGDQRLKDASSSISSGGGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDS
DEVRSLWVKIDLTLLSRIPEHLPQEPGVLSTPAAKDAEGVPPSHTSDTPPEKTLPKSKRK
RKCDNEDDYRESKKTQGDKESSSRLAASTNNTLSANHCNMNINSLAIPINKSEKMLRSPI
SPLCDASKHKYPSEDFTSSGRPHGNGLFTSTSSNKKHKADNQPQSHAGDLPKAAHNNSEN
VLHKSRPQTEPWSPGSNGHRECKRQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKA
LNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLA
ALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPMS
PNPSPTSSVGSQGSLSNTSALSPSPIVSIPQRIHQMAANHVSITNSILHSYDYWEMADSL
AKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLS
NT seq 3558 nt   +upstreamnt  +downstreamnt
atgggagaatcaatttacctgatggtcctgaaaaaaattcaagaaccgtacgtctacgag
ccagataggaatgtgttacggaggaaagaacgggaaagaaggaaccaggaaactcaacaa
gatgacggcacgtttaattccagttactcgctcttcagtgagccctataagactaacaaa
ggggatgagctctccaaccggatccagaataccttaggcaattatgatgaaatgaaagac
tttttaactgatagatccaatcagagtcatctcgttggcgttcccaaacctggggttcct
cagactcctgtgaacaagatcgatgaacattttgttgcagattcgcgagcccaaccccag
ccctcgtctgtctgtagcaccgcatcttccacaccagcagctgtccctgtgcagcagagc
aagaggggcaccgcgggctggcagaaggctgggcacccaccacctgacggccagcagaga
gcaacacaacagggctctctcaggaccttgcttggagatggtgtgggccggcagtcgtcg
cgtgccaaacaagtgtgcagtgtagacgtgggccttcaggcccaggagcggccgcccacg
atggcggccaaacacagcagcggaggacactgtgttcagaactttcctccatccctggct
tccaaacccagcctggtccagcagaaaccaaccgcatacgtgcggcccatggacggccaa
gatcaggctcctgatgagtctcctaagcttaagtcgtctacagaaaccagtgtgcattgc
ccatcctaccggggcgtcccagccagcaagccagagtcggccagggccaaggccaagctg
tccaagttcagcatccccaagcaaggagaggaaagtagatctggagagaacaacagctgt
gtagaagaaatcatccgggagatgacctggctcccacctctttctgctattcaggcacct
ggcaaagtggaaccaagcaaatttccatttccaaataaggactctcagcttgttaccacc
ggacacaataatccaaagaaaggtgatgcagagccagagagcccagacaatggcacatcg
catacatcaatgctagaagatgaccttaagctaagtagtgacgaagaagagaatgaacag
caggcggcccagagacctactctccgcgctctgtctgacagcaccgtggtcccaccgccc
acctgcagagcctccgtgccttcctgcaagggcagcagcagcggcagcagcagcagcagc
agcagctccagcgactcagagagcagctctggatctgactcggagactgagagcagttct
agcgagagcgagggcagcaagcccccccacttctccagccccgaggctgagccggcatct
tccaacaagtggcagctggataaattgctaaacaaagttaatccccacaagcctcctatt
ttgatccagaatgaaagccacgggccggagagcactcagtactatcccccagctaaagac
gaagtgcaagacggtgggaaacttcccgacgtttgcccagccagcctgagagagaaggag
ctcaagagcgcctgcaaggaggagcagaggccgaggacagcgaacaaggccccggggagc
aagggtgtgaagcagaagtccccgcccgcggccgtggctgtgagcgccgccgcccccccg
ccacccgcgctgcccggcgcgccaggggagagcgcccccgccgttgtggttcccccagag
cccaccaaaaccaagccctgtggcaacaacagaacgagtcaccgcaaggagctgcgctcc
tcctcggtggcctgcgagaagcgccgcactcgggggctgagcaggatcgtccccaaatcc
aaggagttcattgagacagagtcctcgtcttcatcctcctcctcggactcggatctggaa
tcagagcaggaggagtacccactgtccaaagcccagaccgtggccaccgctgcctcctcc
gggggagaccagagactgaaggatgcctccagcagcatcagcagtggcggtggccctcgg
gcccctgtaggctctatcaacgccaggaccaccagtgacatcgccaaggagctggaggag
cagttctacacgctggtcccctttggtcggaacgaacttctctcccctctgaaggacagt
gacgaggtcaggtctctctgggtcaaaatcgacctgaccctcctgtccagaatcccagaa
cacctgccccaggagccaggagtcttgagtactcctgctgcaaaggacgctgagggcgta
cccccaagccacacatcggacacaccgcctgaaaagactttgccaaaatccaagaggaaa
cgcaagtgtgacaacgaagacgactacagggagagcaagaagacccagggagacaaagag
agctcttccagactggctgcctcgaccaataacactctgtctgcaaaccactgcaatatg
aacatcaatagcctggcaataccaataaataaaagtgaaaaaatgctccggtcacccatc
tcacccctctgcgatgcatctaaacacaaataccccagtgaggacttcacttcttccggc
cgacctcacggcaatggtttgttcacgtccacctcttccaacaaaaagcataaggccgac
aaccagccacagtctcatgctggagaccttccgaaagccgctcacaacaactctgaaaat
gttctccacaagtcacggccacaaacagagccgtggtctccaggctccaacggccacagg
gaatgcaagaggcagaagcttgtcttcgatgacatgcctcgcagtgcagattattttatg
caagaagctaaacggatgaagcataaagccgatgcaatggtggagaagtttgggaaggct
ttgaactatgcagaagcagccttgtcgttcattgagtgtggaaatgcaatggaacaaggc
cccatggaatccaaatcgccctatacgatgtattcagaaacggtcgagctcataaggtat
gcgatgagactaaaaactcactcaggccctaatgccacaccagaagacaaacagctggct
gcgttatgctaccgatgcctcgccctcctgtactggcggatgtttcgactcaaaagggac
cacgccgtcaagtactccaaagcgctcattgactattttaagaattcatctaaagctgcc
caagccccgtcgccatggggggccagtggaaagagcactggaaccccatcccccatgtct
cccaacccctctcccaccagctccgtggggtctcagggcagcctctccaacaccagcgcc
ctgtccccgtcacccatcgtcagcatcccgcagcgcatccaccagatggcggccaatcac
gtcagcatcaccaacagcatcctccacagctacgactactgggagatggccgacagcctg
gccaaagaaaacagagaattcttcaacgacctggacctgctcatgggccctgtcaccctg
cacagcagcatggagcacctggtccagtactcccagcagggcctgcactggctacgcaac
agcgcccacctgtcatag

DBGET integrated database retrieval system