KEGG   Tupaia chinensis (Chinese tree shrew): 102476728Help
Entry
102476728         CDS       T02978                                 

Gene name
BLVRA
Definition
(RefSeq) biliverdin reductase A
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00860  Porphyrin and chlorophyll metabolism
tup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102476728 (BLVRA)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     102476728 (BLVRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 102476728
NCBI-ProteinID: XP_006148966
Position
Un
AA seq 319 aa AA seqDB search
MGTNHKKTMETPGMTQLLKEEARMNAQPERKFGVVVVGVGRAGSVRMRDLRNPHASSAFL
NLVGFISRRELGSIDEVQQISLEDALSSREVEVAYICSESSSHEDYIRQFLNAGKHVLVE
YPMTLSRAAAEELWALAEQKGKVLHEEHIELLMEEFAFLKKEVVGKDLLKGSLLFTAGPL
EEQRFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVNLETENKRPLSWIE
EKGPGIKRNRYLSFHFKSGSLENVPNVGINKNIFLKDQNIFVQKLLGQFSEEELAAEKKR
ILHCLGLAEEIQKYCHPKK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccaatcacaagaagaccatggagacccctggaatgactcagctgctgaaggaa
gaggccaggatgaatgcacagcctgagaggaagtttggcgtggtggtggttggcgttggc
agagccggctccgtgcggatgagggacttgcggaatccacatgcttcctcggcgtttctg
aatctggttggcttcatatccagacgtgagcttgggagcattgatgaagttcagcaaatt
tctttggaagatgctctttccagccgagaggttgaggtcgcctatatctgcagcgaaagc
tctagccatgaggactacatcaggcagttccttaatgccggcaagcatgtccttgtggag
taccccatgacgctgtctcgggcagcagctgaggaactgtgggcgctggctgagcagaaa
ggaaaagtcttacacgaggagcatattgaactcttaatggaggagtttgccttcctgaag
aaagaagtggtggggaaggacttgctgaaagggtcacttctctttacagctggcccgttg
gaagaacagcggtttggcttccctgcattcagtggcatttctcgactgacctggctggtg
tccctctttggggagctttctcttgtgtctgccactttggaagaaagaaaggaagatcag
tatatgaaaatgactgtgaacctggagacagaaaacaaacgtccactgtcgtggatcgaa
gagaaaggacctggtataaaacgaaacagatatttaagcttccatttcaagtctgggtct
ctggagaatgtgccaaatgtaggaatcaataagaacattttcctgaaagatcaaaatata
tttgtccagaaactcttaggccagttctctgaggaggaactggctgctgaaaagaaacgc
atcctgcactgcctggggcttgcagaagaaatccagaaatactgccatccaaagaagtga

DBGET integrated database retrieval system