KEGG   Tupaia chinensis (Chinese tree shrew): 102477101Help
Entry
102477101         CDS       T02978                                 

Gene name
QDPR
Definition
(RefSeq) quinoid dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00790  Folate biosynthesis
tup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102477101 (QDPR)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     102477101 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2
Motif
Other DBs
NCBI-GeneID: 102477101
NCBI-ProteinID: XP_014447938
Position
Un
AA seq 361 aa AA seqDB search
MLVGAGHPRGLRATTGAAGIFQTRAALCSKARSPNTTQGFLATCPPQGLLAALFTRTLRL
QRAPGSWRIFITSAVVLRPGPARPGDGAPLAQQTGSAPGQRGRASSAGEGIGASGRGFGA
RGWALRAADTLLRGWLLPPPRGTRQFAERALQWVASIDVVENEEASASVIVRMTDSFTEQ
ADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSVWTSAISSHLAA
KHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPAGAAAIAVLPV
TLDTPMNRKAMPEADFSSWTPLDFLVETFHDWITGKSRPSSGSLIQVVTVEGRTELTPAY
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgggtgcaggtcaccccaggggtctccgagccaccacgggggccgccggcatc
ttccagacacgggcggcactctgctccaaggccaggtctccaaacaccactcagggcttc
ctggccacctgtcctccccagggcctcctggccgccttgtttactcggaccctgcggctg
cagagagctcctgggagctggcgcatcttcatcacgtccgccgtcgtcctccgccccggt
cctgcccgccccggagacggcgcccccctcgcccaacagaccggatccgccccggggcag
cggggccgggcttcgtcggccggggaaggaatcggggcctcggggcgtggctttggggcc
cggggctgggctctgcgagccgccgacacgctcttacgggggtggctgttacccccgccc
cgtgggactcggcagtttgcagagcgagccctgcagtgggtggccagcatcgatgtggtg
gagaacgaggaggccagtgccagtgtcattgtccgaatgacagactccttcaccgagcag
gcggaccaggtcactgccgaggtcggaaagctcctgggtgaagagaaggtggacgcgatt
ctctgcgtggccggaggatgggccgggggcaacgccaagtccaagtctctctttaaaaac
tgtgacctgatgtggaagcagagcgtgtggacgtcggccatctccagccacctggccgcc
aagcacctcaaggaaggcggcctcctgaccttggccggcgccaaggccgccctcgacggg
acccccgggatgatcggctacggcatggccaagggtgccgtccaccagctctgccagagc
ctggccgggaagaacagcggcatgcccgccggggcggccgccattgctgtgctcccggtc
accctggacaccccgatgaacaggaaagcgatgcccgaggctgacttcagctcctggacg
cccttggacttcctggtcgaaaccttccacgactggatcacggggaaaagccgcccgagc
tctggaagtctgatccaggtggtgacggtggagggcaggacggagctcaccccggcgtat
ttttag

DBGET integrated database retrieval system