KEGG   Tupaia chinensis (Chinese tree shrew): 102477402Help
Entry
102477402         CDS       T02978                                 

Gene name
ETNPPL
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102477402 (ETNPPL)
Enzymes [BR:tup01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     102477402 (ETNPPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102477402
NCBI-ProteinID: XP_006162301
Position
Un
AA seq 497 aa AA seqDB search
MSERYCKEDTLALRGRHIGPSCKVFFPADPIKIVRARGQYMFDEKGAQYLDCINNVAHVG
HCHPGVVQAALKQMEVLNTNSRFLHDNIVEYARRLTATLPPGLSVCYFTNSGSEANDLAL
RLARQFRGHQDVITLDHAYHGHLTSLIEISPYKFLNGKDAKKEFVHVAPAPDTYRGPFRE
DHADPAGAYADEVKTIIEEAQGRGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVRGAG
GVFIADEVQVGFGRAGKHFWSFQMHGEDFIPDIVTMGKPMGNGHPMACVVTTKEIAEAFS
SSGMEYFNTYGGNPVSCAVGLAVLDIIESEDLQGNATRVGNYLVELLQKQKAKHPLIGDI
RGIGLFIGIDLVQDQNRTPATAEAQHVIYQMKERGVLLSADGPHRNVLKIKPPMCFTEGD
ATLMVDQLDGILTVLEKAGEAQTESVSSADTPRRMKAPEACSDGLSGSSAGSSENPSTKR
NGACTDRHSLLSKRLRT
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcggtactgcaaggaggacaccctggctctgcgcggccggcacatcgggccc
tcatgcaaagtgttcttccctgcggaccccatcaaaatcgtgcgtgcccgtggccagtac
atgttcgacgagaagggcgcgcagtacctggactgcatcaacaacgtcgcccacgtgggg
cactgtcaccccggagtggtgcaggcggccctgaagcagatggaggtgctcaacaccaac
tccaggttcctgcacgacaacatcgtggagtacgccaggcgcctcacagcgacactgccg
cccgggctctctgtgtgctacttcaccaactccgggtccgaggccaacgacctagcccta
cgcctggctcggcagttcagaggccaccaagacgtgatcacgctcgaccacgcttaccat
ggtcacctcacgtctttgattgagattagtccctacaaatttctgaacggcaaagatgcc
aagaaggaatttgtgcacgtggcaccagctccagacacgtacagaggcccattccgagag
gaccacgctgaccccgccggggcctacgccgatgaagtgaagacgatcattgaagaggct
cagggccgggggaggaagatcgctgcatttattgccgaatccatgcagagctgtggtgga
caaataatccctccagcaggctacttccagaaagtggcagagtatgtccgtggggctggg
ggcgtgtttatagctgacgaagttcaggtcggctttggccgagctgggaaacatttctgg
agcttccaaatgcatggtgaagacttcattccagacattgtcaccatgggaaagccaatg
ggcaatggccaccccatggcatgtgtggtgacgaccaaagaaatcgcagaagccttcagc
agctctgggatggagtatttcaacacgtatggagggaacccggtgtcctgcgctgttggt
ttggctgtcctggatatcattgaaagtgaggaccttcaaggaaatgccaccagagtaggg
aattaccttgtcgagttactacagaaacagaaggctaagcaccctctaataggagacatt
cgaggcattggccttttcattggcatcgacctggtgcaggaccagaacaggaccccagcc
accgccgaggctcagcacgtcatctaccagatgaaagagagaggtgtgctcctgagcgcc
gacggccctcacagaaacgtgctgaagataaagccgcccatgtgcttcacggaaggagat
gccacgctcatggtggaccagctggacgggattctcacagttttagaaaaagctggggaa
gcccagactgaaagcgtgagctctgcggacactccacgcagaatgaaggctccagaggcg
tgctctgacgggctcagcggcagctcggccggctccagcgagaatcccagcaccaagagg
aacggggcgtgcacagacagacactcgctgctcagcaagcggctccggacctga

DBGET integrated database retrieval system