KEGG   Tupaia chinensis (Chinese tree shrew): 102477469Help
Entry
102477469         CDS       T02978                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00561  Glycerolipid metabolism
tup01100  Metabolic pathways
tup04714  Thermogenesis
tup04723  Retrograde endocannabinoid signaling
tup04923  Regulation of lipolysis in adipocytes
Module
tup_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    102477469 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102477469 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    102477469 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    102477469 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tup01002]
    102477469 (MGLL)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102477469 (MGLL)
Peptidases [BR:tup01002]
 Serine Peptidases
  Family S33
   102477469 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 Thioesterase Abhydrolase_5 LIDHydrolase PGAP1 Abhydrolase_3 BAAT_C Abhydrolase_2 DUF1057 Chlorophyllase2 TMEM117
Motif
Other DBs
NCBI-GeneID: 102477469
NCBI-ProteinID: XP_006169870
Position
Un
AA seq 377 aa AA seqDB search
MSHRPENSELPGSHTEPGGRNHAQRASSRAVYWPRPPTPRMSRGTQTDVHLADPGVGFSQ
GHRQLLCGLKDSSRMPEGSSPRRTPQNVPYQDLPHLVNPDGQYLFCRYWKPAGTPKALVF
VSHGAGEHCGRYAELAQMLVGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDT
VQKDHPGLPVFLLGHSMGGAIAILTAVERPGHFSGMVLISPLVLTNPESATTFKVLAARV
LNLILPNLSLGPIDSSVLSRNKTEVALYDADPLICRAGLKVCFGTQLLNAVSRVERAMPR
LTAPLLLLQGSADRLCDSRGAHLLQEQEQDTEGERQIYEGAYHVLHKELPEVTSSVFQEI
STWLSQRVGAAGARCPP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaccgtcctgaaaactcagagcttcctggaagccacacagaacccgggggcagg
aaccacgcacagagagcgtctagcagggctgtctactggccgcgccctcccactccgcgt
atgtcaagaggcacacagacggatgtccacttggctgacccgggagtggggttctctcag
ggtcacaggcagcttctttgtggactcaaggactcttccagaatgcccgagggaagctct
cccaggcggaccccccagaacgttccgtaccaggacctccctcacctggtcaaccctgac
ggacagtacctattctgcaggtactggaaacccgcggggacacccaaggccctggtcttc
gtgtcacatggagctggggagcactgtggccgctatgccgagctggcccagatgctggtg
gggttggacctgctggtgttcgcccacgaccacgtcggccacggacagagcgaaggggag
aggatggtggtgtccgacttccacgtctttgtcagggacgtgctgcagcacgtggacacc
gtgcagaaggaccaccccgggctccccgtcttcctcctgggccactccatggggggcgcc
atcgccatcctcaccgcggtggagaggccaggccacttctccggcatggtgttgatctcc
cctctggtcctcaccaacccagagtcggccacgaccttcaaggtcctggctgccagagtg
ctcaacctcatcctgccgaacctatccctggggcccatcgactccagtgtactctctcgg
aataagacggaggtggcgctgtacgacgcggacccgcttatctgccgggcgggcctgaag
gtgtgcttcgggacccagctgctgaacgctgtctcgcgggtggagcgcgccatgcccagg
ctgacggcgcccctcttgctgctccagggctcggccgaccgcctctgtgacagcaggggc
gcccacctgctccaggagcaagaacaagacactgaaggtgagcggcagatctacgaaggt
gcctaccatgtcctgcacaaggagctccccgaggtgaccagctccgtcttccaggagatc
agcacgtggctctcccagagggtgggcgccgcgggagcccggtgcccaccctga

DBGET integrated database retrieval system