KEGG   Tupaia chinensis (Chinese tree shrew): 102478927Help
Entry
102478927         CDS       T02978                                 

Gene name
ADSS
Definition
(RefSeq) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup00250  Alanine, aspartate and glutamate metabolism
tup01100  Metabolic pathways
Module
tup_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102478927 (ADSS)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102478927 (ADSS)
Enzymes [BR:tup01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     102478927 (ADSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt Spore_YpjB
Motif
Other DBs
NCBI-GeneID: 102478927
NCBI-ProteinID: XP_006157293
Position
Un
AA seq 474 aa AA seqDB search
MAFAETNPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
EGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMERIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVSLRYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGAIIPHFPANQEVLNKVEVQYKTLPGWNTDISNARTFKE
LPVNAQNYVRFIEDELQIPDRVSLSPSSCLSRPAGSLALECPGSEFYFSYLLAK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgccgagaccaacccggcggcatcctccctgcccaacggcgactgcggccgt
cccagggcgcgtcccggagggaaccgggtgacagtggtgcttggcgcgcagtggggcgac
gaaggcaaagggaaggtggtggatctgctggctcaggacgccgacatcgtgtgccgctgc
cagggaggaaataatgctggccatacagttgttgtagattctgtggaatatgactttcat
cttttacccagtggaataattaacccgaatgttactgcattcattggaaatggtgtggta
attcatctaccaggattatttgaagaagcagaaaaaaatgttcaaaaaggaaaaggtcta
gaaggctgggagaaaaggcttatcatatctgacagagctcatattgtatttgattttcat
caagcagctgatggtatccaggaacaacaaagacaagaacaagcagggaaaaatttgggt
accacaaaaaagggcattggcccagtttattcttctaaagctgctcggagtggacttagg
atgtgcgatcttgtttctgacttcgatggcttctctgagaggttcaaagttcttgctaac
caatataaatctatatatcccactttggaaatagacattgaaggtgaattacaaaaactc
aagggttatatggaaagaattaagccaatggtgagagatggagtttattttctatatgag
gccctacatggaccaccaaagaaaatcctggtagaaggtgcaaatgcagcacttctagat
attgattttgggacctatccttttgtaacttcttcaaactgtaccgtgggaggtgtttgt
acaggtttgggtatgccacctcaaaatgtcggagaagtatatggagttgtgaaagcttac
acaactagagttggcattggtgcctttcctacagagcaagacaatgaaattggagagttg
ctacaaacaaggggtagagagtttggtgtaactactggaaggaaaagaagatgtggctgg
ttggaccttgtttcactcagatatgctcatatgatcaatggatttactgcgttggcactt
accaagttggatattttggacatgtttacagaaatcaaagttggagttgcctataagtta
gatggtgcaatcatacctcatttcccagcaaaccaagaagtcttaaataaagttgaagtt
cagtataagactctcccaggctggaacacagacatatcaaatgcaaggacttttaaagaa
ctacctgttaatgcacaaaattatgttcgatttattgaagatgaacttcaaattccggac
agggtctcactatcaccatcctcctgcctcagtcgtccagctgggtctctagctctagaa
tgtcctgggtctgaattctacttctcctacctcctagccaagtga

DBGET integrated database retrieval system