KEGG   Tupaia chinensis (Chinese tree shrew): 102483055Help
Entry
102483055         CDS       T02978                                 

Gene name
BMPR1A
Definition
(RefSeq) bone morphogenetic protein receptor type 1A
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04060  Cytokine-cytokine receptor interaction
tup04350  TGF-beta signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102483055 (BMPR1A)
   04390 Hippo signaling pathway
    102483055 (BMPR1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102483055 (BMPR1A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102483055 (BMPR1A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102483055 (BMPR1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102483055 (BMPR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tup04090]
    102483055 (BMPR1A)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102483055 (BMPR1A)
Protein kinases [BR:tup01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   102483055 (BMPR1A)
CD molecules [BR:tup04090]
 Proteins
  102483055 (BMPR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2 APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102483055
NCBI-ProteinID: XP_006147817
Position
Un
AA seq 532 aa AA seqDB search
MTQLCIYTRLLGALLFIISHAQGQNLDSMLHGSGGKADSEQKKSERGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVMDPFLDGSVRWLVVLISMAVCVIAMTIFSSCFCYKHYC
KTISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKRNGSCCIADLGLAVKFNSDTNEVDVPLNSRVGTKRYMAPEVLDESLNKN
HFQPYVMADIYSFGLVIWEMARRCITGGIVEEHQLPYYNMVPGDPSYEDMREVVCVKRLR
PTVSNRWNGDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactcagctgtgtatttacaccaggttattgggagccttgctgttcatcatttctcat
gctcaagggcagaacctagacagcatgctccacggcagcggggggaaggccgactctgag
cagaagaagtctgagcgtggggtcaccttagcaccggaggacaccttgccttttttaaag
tgctactgctcaggacactgcccggacgacgctattaacaacacgtgcataactaatgga
cactgctttgccatcatagaagaggatgaccagggagagaccaccttagcttcagggtgc
atgaagtacgaaggatcggattttcagtgcaaggattcgccgaaagcccagctccgccgg
accatcgagtgctgtcggaccaacctgtgtaaccagtacctgcagcccaccctgcccccg
gtggtcatggacccctttctcgacggcagcgtccggtggctggtcgtcctcatctccatg
gctgtctgcgtgatcgctatgaccatcttttccagctgcttctgttacaagcattactgc
aagaccatctcgagcagacgtcgatacaatcgtgacttagaacaggatgaagcgttcatc
ccagtcggggaatccctgaaagacctcatcgaccagtcgcagagttctggcagtgggtcc
ggcctgcctttgttggttcagcgaactattgccaaacagattcagatggtccggcaagtt
ggtaaaggccgatatggagaagtgtggatgggtaaatggcgtggtgagaaagtggcagtg
aaggtgttttttaccacggaagaagcgagctggtttcgagaaacggaaatctaccagact
gtgctaatgcgccatgagaacatcctcggttttatagcagcggacattaaaggcaccggc
tcctggacgcagctgtacctgatcacggactaccacgagaacggctccctctatgacttc
ctcaagtgtgccacgctggacaccagggccctgctcaagctggcctactcggcggcctgc
ggcctgtgccacctccacacggagatctacggcacgcaggggaaacctgccattgcccat
cgcgacctgaagagcaagaacatcctcatcaagaggaacggcagctgctgcatcgccgac
ctgggcctcgccgtcaagttcaacagtgacacgaacgaagtcgatgtgcccttgaacagc
agagtgggcaccaagcgctacatggctccggaagtgctggacgaaagcctgaataaaaac
cacttccagccctacgtcatggccgacatctacagcttcggcctggtcatctgggagatg
gctcgtcggtgcatcacgggaggcatcgtcgaggagcaccagctgccctactacaacatg
gtgcctggcgacccgtcctacgaggacatgcgggaggtggtgtgcgtcaagcgcctgcgg
ccgaccgtgtctaaccggtggaacggtgacgaatgtctgcgggcggtgttgaagctcatg
tccgagtgctgggcccacaacccggcgtcccgactgacggcgctgagaatcaagaagaca
cttgccaagatggtggagtcccaggatgtcaagatttga

DBGET integrated database retrieval system