KEGG   Tupaia chinensis (Chinese tree shrew): 102483375
Entry
102483375         CDS       T02978                                 

Gene name
ASIC1
Definition
(RefSeq) acid sensing ion channel subunit 1
  KO
K04829  acid-sensing ion channel 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102483375 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102483375 (ASIC1)
Ion channels [BR:tup04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102483375 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 102483375
NCBI-ProteinID: XP_006168241
Position
Un
AA seq 559 aa
MPIQIFCSVSFSSGEEAPGPLEDVWGPHHHQQQRDNSESEEEEEKEKESARKAADEGDSP
VDLVAFANNCTLHGASHVFVEGGPGPRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHVT
LLDEVATTELAFPAITLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAF
SGEPFNLHRFYNRSCHRLEDMLLYCSYQGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRL
KTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAP
GFQTFVACQEQRLIYLPPPWGTCKAVTPDSDFFDSYSITACRIDCETRYLVENCNCRMVH
MPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKY
LAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILT
VLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTY
AANILPHHPARGTFEDFTC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttttgttctgtgtcattctcttctggagaggaggcaccagggcct
ctggaagatgtttggggtccccaccatcaccagcagcagcgggacaactcggaatcagaa
gaagaggaagagaaggaaaaggagtcagcgaggaaggcggccgacgagggggattcgcct
gtggacttggtggcctttgccaacaactgtaccctccacggtgccagccacgtctttgtg
gaggggggcccagggccaagacaggccctgtgggcagtggcctttgtcctggcactgggt
gcctttctgtgtcaggtaggggaccgcgttgcctattatctcagctacccacacgtgact
ctgcttgacgaggtggccaccacggagctggccttcccggccatcaccctctgcaacacc
aacgccgtgcggttgtctcagcttagctaccccgacttgctttatctggcccccatgctg
ggtctggacgaaagtgacgaccctggcgtgcctctcgctccaccagggccggaggccttc
tccggggagccctttaacctgcaccgcttttacaatcgctcctgccaccggctggaggac
atgctgctctattgctcctaccaaggggggccctgtggcccgcacaacttctccgtggtc
ttcactcggtatggaaagtgctacacattcaactccggcagagatgggcggccacggctg
aagaccatgaaaggtggcacaggcaacgggctggaaatcatgctggacatccagcaggac
gagtacctgcctgtgtggggggagactgatgagacgtccttcgaagcgggcatcaaagtg
cagatccacagccaggatgagcctcctttcatcgaccagctgggctttggcgtggcccca
ggcttccagaccttcgtggcctgccaagagcagcggctcatctacctgcccccgccctgg
ggcacctgcaaagctgttaccccggactcggatttcttcgactcctacagcatcaccgcc
tgccgcatagactgtgagacgcgctacctagtggagaactgcaactgccgcatggtgcac
atgccaggggatgccccatactgcaccccagagcagtacaaggagtgtgcagatcctgct
ctggacttcttggtagagaaggaccaggagtactgcgtgtgtgaaatgccctgcaacctg
acccgctatggcaaggagctgtccatggtcaagatccccagcaaagcctcagccaaatac
ctggctaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggac
attttctttgaagtcctcaactatgagaccattgagcagaagaaggcttatgagattgca
gggctcctgggtgacattgggggccagatggggctgttcatcggagccagcatcctcacg
gtgctggaactctttgattacgcctacgaggtcattaagcacaagctctgcagacgaggg
aagtgccagaaggaggccaaaaggagcagcgcggacaagggcgtcgcccttagcctggac
gatgtcaaaagacacaatccgtgcgagagccttcggggccatcctgccgggatgacgtac
gccgccaacatcctacctcaccatccggcccgaggcacgtttgaggactttacctgctga

DBGET integrated database retrieval system