KEGG   Tupaia chinensis (Chinese tree shrew): 102484215Help
Entry
102484215         CDS       T02978                                 

Gene name
ACOD1, IRG1
Definition
(RefSeq) aconitate decarboxylase 1
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    102484215 (ACOD1)
Enzymes [BR:tup01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     102484215 (ACOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 102484215
NCBI-ProteinID: XP_006140036
Position
Un
AA seq 647 aa AA seqDB search
MGVELPLTPVLCVDGHEEGRQHLETHTPQKSRPHCHITLSRCNDKSGQFPWVINQYGLAR
RSHMTEIKVLAKLHSHLEIRKESVSKILGRAYSLVAIKFVECSFFKGSNKGNESADWSWF
RGHLPVKCQCFPGLCTLMSLYLWLKLCSQDQHQFHQKVECIIVVILFLLQSVTESFAKVI
HGLKVGHLTDHVIQKSKRMILDTLGVGFLGTSTEVFCKASQYSKIYSSNLSSSVWGQPDF
RLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALSEAFPQRPAFSGLDLLLAF
NIGVEVQGRLMHFSKEANDIPKRFHPPSVVGTLGSAAAASKFLGLSLAKCQEALAIAVSH
AGAPMANAATQTKPLHVGNAARHGLEAAFLAMLGLQGNKQVLDMETGFGAFYANYSPELL
PNLDSHTWLLDQQDVAFKRFPAHLATHWVADAAASVRKHLVADRMLLPTDHIRRIVLRIP
DVQYVNRPFPDSEHEARHSFQYVACAMLLDGSVTISSFHKHRINRPQMRELLRKVELEHP
LDNQPSFNRLYCEISVTLRDGASFTVRSDTFYGHWRKPLSQKDLEEKFRANTSGVLSCDT
VESLIKVVEKLEDLEDCSVLTTLLKGPSPGQVLQSSPASIIPTRNLS
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagagctaccactgacgcctgtgctgtgtgttgatggccacgaggaaggcagg
cagcacctggaaacccacacgccccagaagtcccgcccacactgtcacatcacgctctcc
agatgcaatgacaagagtgggcagtttccatgggtcataaatcagtatggcttagctaga
cggtctcacatgactgaaatcaaggtattggcaaagctgcattcacatctggaaattagg
aaagaatctgtttctaagattcttggcagagcttatagtcttgtggctataaaattcgtg
gagtgtagcttcttcaaaggcagcaacaaaggaaatgagtctgctgattggagctggttc
aggggtcatttgccagttaaatgtcagtgtttcccagggctctgtactctcatgagtcta
tacctgtggctcaaactgtgttctcaagaccagcatcagttccaccagaaagtggagtgt
atcattgttgtaatactgtttcttttacagtctgtcacagaaagttttgccaaagtgatc
catggcctgaaagtgggacacctgacagatcacgtgattcagaagagcaagaggatgatt
ctagatactctaggtgttgggttcctgggaaccagtacagaagtattttgcaaagccagc
caatacagcaaaatctacagttccaatttatccagcagtgtttggggtcagccagacttc
aggctcccgcctacatatgctgcttttgttaatggtgtggctattcactcgatggatttt
gatgacacgtggcaccctgccacccacccttctggggctgttcttcctgtactcacagct
ttatcagaagcctttcctcagaggccagcattttctggccttgaccttctgctggctttc
aatattggtgttgaagtgcaaggccgattaatgcatttctccaaagaagctaatgacata
ccaaagagatttcatcccccttcagtggtaggaactttggggagtgctgctgctgcatct
aagtttttaggacttagcttggcaaagtgccaagaggccctggccattgccgtttcccat
gctggagcacccatggccaacgctgctactcagaccaagccccttcacgttggcaatgca
gccaggcatggtttagaggctgcttttctggcaatgctgggtctccaaggaaacaagcag
gtcctggacatggagacaggatttggggccttctatgccaactattcccctgaactcctc
ccaaacttagactctcacacttggctgctggaccagcaggatgtggccttcaagcgtttc
cctgctcatttggccacccactgggtggcagatgcagctgcatctgtgagaaagcacctt
gtagctgacagaatgctgcttcccactgaccatatcaggaggattgtgctcaggattcca
gatgtccagtatgtaaataggcccttcccagactcagagcatgaggctcggcattctttc
cagtatgtagcctgtgctatgctgcttgacgggagtgtcactatctcgtccttccacaaa
caccggatcaacaggccacagatgagagagctgctcaggaaagtggagctggagcaccct
ctggacaaccagccaagcttcaacaggctctactgtgagataagtgtcaccctcagggac
ggggcctccttcaccgtgcgctccgataccttctatggtcactggaggaaaccattgagc
cagaaggacttggaggaaaagttcagagccaacacctctggggtactgtcctgtgacaca
gtggaaagtcttataaaggtagtagaaaagctggaagacctagaagactgttctgtatta
actacactcctgaaaggaccctctccaggacaggtgcttcaaagctctcctgcaagtata
attccaacacgcaatctctcctga

DBGET integrated database retrieval system