KEGG   Tupaia chinensis (Chinese tree shrew): 102485301Help
Entry
102485301         CDS       T02978                                 

Gene name
HPGDS
Definition
(RefSeq) hematopoietic prostaglandin D synthase
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00480  Glutathione metabolism
tup00590  Arachidonic acid metabolism
tup00980  Metabolism of xenobiotics by cytochrome P450
tup00982  Drug metabolism - cytochrome P450
tup01100  Metabolic pathways
tup05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102485301 (HPGDS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102485301 (HPGDS)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102485301 (HPGDS)
   00982 Drug metabolism - cytochrome P450
    102485301 (HPGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102485301 (HPGDS)
Enzymes [BR:tup01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102485301 (HPGDS)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     102485301 (HPGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_N_3 GST_C GST_N_2 GST_C_6 GST_N_4 GST_C_2 Lipoprotein_8
Motif
Other DBs
NCBI-GeneID: 102485301
NCBI-ProteinID: XP_006164556
Position
Un
AA seq 199 aa AA seqDB search
MPSYKLTYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWLKIKSTVPFGKIPILEVDGFI
LHQSLAIARYLTKNTDLAGKTEVEQCQVDAIVDTLDDFMSRFPWAEKTQDIKDRMFNELL
TYDAPHLLQDLDTYLGEKEWFVGNTVTWADFYWDICCTTLLVLKPDLLDVRPRLKALQKK
VQAIPAIADWIQRRPPTKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgccaagctacaaactcacttattttaatatgagggggagagcagaaatcatccggtac
atatttgcttatttggacatcaaatatgaagaccatagaatagaacaagctgactggctc
aaaatcaaatcaactgttccatttggcaaaatccccattttggaagtcgatggatttatc
cttcaccagagcctagcaatagcgagatacttgaccaaaaacacagatctggctgggaaa
acagaagtggaacaatgccaagttgatgccattgtggacactttggatgatttcatgtca
cgttttccttgggcagagaaaacgcaggatataaaagatcgaatgtttaacgaattgctc
acgtacgatgcacctcaccttctgcaagatttggacacatatttaggggaaaaagagtgg
tttgttggtaacactgtaacatgggcggacttctactgggatatctgctgcaccacgctg
ctggtcctcaagcctgacttgctggacgtccgccccaggctgaaggccttgcagaagaaa
gtccaagccattcctgccatagctgactggatccagcggaggccccccaccaaactctag

DBGET integrated database retrieval system