KEGG   Tupaia chinensis (Chinese tree shrew): 102488385
Entry
102488385         CDS       T02978                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup05200  Pathways in cancer
tup05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102488385 (MECOM)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102488385 (MECOM)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    102488385 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102488385 (MECOM)
Transcription factors [BR:tup03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    102488385 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 PyrI_C
Other DBs
NCBI-GeneID: 102488385
NCBI-ProteinID: XP_006150338
Position
Un
AA seq 1154 aa
MPGAGLGVWTKRKIEVGERFGPYVGEQESNLKDPNYGWEILDEFCNVKFCIDASQPDVGS
WLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEDYPHETMAPDIHEE
RQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQKLESENDLREIHAIQECK
ECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAK
QVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSY
TQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISL
PGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPL
IPASSPVKGLSSTEQSNKSQSPLMTHPQILPATQDILKALSKHPPVGDNKPVELQPERSS
EERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDIESDKEKFKENGKMFKDKVSP
LQNLASITNKKEYSNHSIFSPSLEEQTAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKK
VGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESPFDLT
TKRKDEKPLTPVPSKPPATPATSQDQPLDLSMGSRSRASGTKLTEPRKNHVFGEKKGSHI
EPRPASDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQFQLPDQ
RSWMSAIENMAEKLESFSALKPEASELLQSVPSMFNFRAPPSALPENLLRKGKERYTCRY
CGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDR
CFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDAYFTEIRNFIGNSNHG
SQSPRNAEERMNGSHFKDEKALVASQNSDLLDDDEVDDEVLLDEEDEETDIPGKTGKEPV
TSNLHEGNPEDDYEETSVLEMGCKTSPARYKEEEYKTGLSALDHIRHFTDSLKMRKMEEN
QYTEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSTSHSSSNVWHSMAR
AAAESSAIQSMSHV
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgcctggagcaggactaggagtatggaccaaaaggaagattgaagtaggtgaaaggttt
gggccttacgtgggagagcaggaatcaaacctgaaggaccccaactatggatgggagatc
ttagatgagttttgcaatgtgaagttctgcatagatgccagtcaaccagatgtggggagc
tggctcaagtatatcaggttcgctggctgttacgatcagcacaacctcgttgcatgtcag
ataaatgatcagatattctatagagtagtcgcagacatcgcaccaggggaggagctcctg
ctgttcatgaagagtgaagactatccccatgaaactatggcgccggatatccacgaagaa
cggcagtatcgttgtgaggactgtgatcagctctttgaatctaaggctgaactagctgat
caccagaagtttccatgcagtactcctcactcagcattttcaatggtggaagaggacttt
caacaaaaactcgaaagtgagaatgatctccgagagatacatgcgatccaggagtgtaag
gaatgtgaccaagtgttccctgacttgcaaagcctggagaaacacatgttgtcacatact
gaagagagagaatacaagtgtgatcagtgtcccaaggcatttaactggaagtccaattta
attcgccaccagatgtcacatgacagtggaaagcactatgaatgtgaaaactgtgccaag
caggttttcacggaccctagcaaccttcagcggcacattcgctctcagcatgttggtgcc
cgggcccacgcttgcccggagtgtggtaaaacatttgccacgtcgtcaggcctcaaacaa
cacaagcacatccacagcagtgtgaagccctttatctgtgaggtctgccataagtcctat
actcagttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatc
aagtgcaaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagg
ttttgtgagggcaagaaccattttgcggcaggtggattttttggccaaggcatttcactt
cctggaaccccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggc
cttgctgactattttggtgccaataggcatcctgctggtcttacctttccaacagctcct
ggattttcttttagcttccctggtctgtttccttccggcttgtaccacaggcctcctttg
atacctgctagctctcctgttaaaggactatcaagtactgaacagtcaaacaaaagtcaa
agtcccctcatgacacatcctcagatactgccagctacacaggatattttgaaggcacta
tctaaacacccacctgtaggggacaataagccagtggagctccagcccgagaggtcctct
gaagagaggccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtc
agtacgccaagtggcagtgacctggaaacaacctcgggctctgatctggaaagtgacatt
gaaagtgataaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagccct
cttcagaatctggcttcaataactaataagaaagaatacagcaatcattccattttctca
ccatctttagaggagcaaactgccgtgtcaggagctgtgaatgattctataaaggctatt
gcttctattgctgagaaatactttggttcaacaggactggtggggctgcaagacaaaaaa
gttggagctttaccttacccttccatgtttcccctcccattttttccagcattctctcaa
tcaatgtacccatttcctgatagagacttgagatcgttacctttgaaaatggaaccccaa
tcaccaagtgaagtaaagaaactgcagaagggaagctcagagtccccctttgatctcacc
actaaaagaaaggatgagaagcccttgactcccgtcccctccaagcctccagcaacacct
gccacaagccaagaccagccactggatctaagtatgggcagtaggagtagagccagtgga
acaaagctgactgaacctcgaaaaaaccatgtgtttggggagaagaaaggaagtcacatt
gagccaagacctgcttcagatggttccttgcagcatgcaagaccgactcctttctttatg
gaccctatttacagagtagagaaaagaaaactaactgacccacttgaagctttaaaagag
aaatacttgagaccgtctccaggattcttgtttcacccacaattccaactgcctgatcag
agaagttggatgtcagctattgaaaacatggcggaaaagctagagagcttcagtgccctg
aaacccgaggccagtgagcttctgcagtcggtgccctccatgtttaacttcagagctcct
cccagcgcgctcccagagaacctcctgcggaagggaaaggagcgctatacctgcagatac
tgtggcaagatttttccaaggtctgcaaacctaacgcgacacttgagaacccacacagga
gaacagccttacagatgcaaatactgcgacagatccttcagcatatcttccaacttgcaa
cggcatgttcgtaatatccacaataaggagaagccgtttaagtgtcacctatgtgatagg
tgttttggtcaacaaaccaatttagacagacacctaaagaaacatgagaacgggaacatg
tctggtactgcaacatcttcgcctcattctgaattggagagtacaggtgcaattctggat
gacaaagaagatgcttacttcacagagattcggaatttcatcgggaatagcaaccacggt
agccagtcccccaggaatgcagaggagagaatgaatggcagtcactttaaggatgaaaag
gctttggttgccagtcagaattcggatttactggatgatgatgaagtagatgacgaggtg
ttattagatgaggaggacgaagagactgacattcctggaaaaacaggaaaggaaccagtg
acaagtaacttacatgaaggaaatcctgaggatgactatgaagaaaccagtgtcctggaa
atgggctgcaagacatctccagcgaggtataaagaggaagaatataaaactggactttct
gctctagatcatataaggcacttcacagatagcctcaaaatgaggaaaatggaagaaaat
caatatactgaagcagaactgtcttcttttagtacttctcatgtgccagaggaacttaaa
cagccgttacacagaaagtccaaatcacaggcatatgctatgatgttgtcactgtctgac
aaggagtccctccattctacatcccacagctcttccaacgtgtggcacagtatggcaaga
gccgccgcggagtccagtgccatccagtccatgagccacgtatga

DBGET integrated database retrieval system